KEGG   Bacillus sp. BS34A: BS34A_21480Help
Entry
BS34A_21480       CDS       T03833                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00020  Citrate cycle (TCA cycle)
bacl00310  Lysine degradation
bacl00380  Tryptophan metabolism
bacl01100  Metabolic pathways
bacl01110  Biosynthesis of secondary metabolites
bacl01120  Microbial metabolism in diverse environments
bacl01130  Biosynthesis of antibiotics
bacl01200  Carbon metabolism
Module
bacl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BS34A_21480 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BS34A_21480 (sucA)
   00380 Tryptophan metabolism
    BS34A_21480 (sucA)
Enzymes [BR:bacl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BS34A_21480 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N Amidinotransf
Motif
Other DBs
NCBI-ProteinID: CEJ77564
LinkDB All DBs
Position
I:complement(2126788..2129622)
Genome map
AA seq 944 aa AA seqDB search
MFQNSMKQRMNWEDFYGPNLGYALELYDQYTQDPNSIDPDLKEMFDELGAPPSDIKEASG
TKEKGRVTADLIQKIASAVRLAEDIRTYGHLNASVNPLRKDEKKSELFPLSDYGLTEEEI
KAIPASVICKDAPKNISNGLEAIQYLRNTYKRTISFEFDHVHDFKEREWLTRKIESGELF
QKNSAEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKSGTT
SVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSIGISYGWTGDVKYHLG
ANRELQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQSGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESAESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKQIFAEKLVKEGVVTEEVVQNIEKSVTKRIEDAYQKVPSKKEHTACEIELPE
PVSNGFPDVDTSIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGKEFVPLHHLSDCSTSFAVHN
SPLSEGSVLGFEYGYNVHSPETLVLWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRIERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFQPVYEQSGLSHDYEKVTRLVLSSGKVSIDISDHF
NKLEDGKEWLHIARIEQLYPFPAKGVKELFAKLPNLKEIVWVQEEPQNMGAWGYISPYLT
EIAPEGVSVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaacgaatgaattgggaagatttttacggtccgaacctc
ggctatgcgctggagctttacgatcagtatacccaggatccgaacagcattgacccggat
ttgaaggaaatgttcgacgagctcggtgctccgccaagcgatataaaagaggcctcggga
acaaaagaaaagggacgtgttacagccgatctgattcaaaagatcgcatccgcagtcaga
cttgcagaagatatccgaacctatggccatttgaacgcttccgtcaatccgctcagaaag
gatgagaaaaagagcgaactttttccattatccgattacgggctaacagaagaggaaata
aaagcaatacctgcgtctgtcatctgcaaagacgctcctaaaaacatttcgaacggttta
gaagccattcagtatttacgaaatacgtataaaagaaccatctcttttgaatttgaccat
gtgcatgacttcaaagagcgcgagtggctgacaagaaagattgaatctggcgagctgttc
cagaagaactcagctgaaaagctgtcagctgtgctggaaagattgacagaagtagagggc
tttgagcagtttttgcaccgcacattcgtcgggcagaagcgcttttccattgagggtctg
gacgctcttgttccagtgcttgatgacattattgcacaatctgtcaaatcaggcacgaca
agtgtcaacatcgggatggcgcacaggggacgcctgaatgtcttggcacatgtgctcggc
aaaccgtatgaaatcatcttctctgaattccagcatgcgccgaacaaagatcttgtaccg
tctgagggatccattggaatcagctacggatggacgggggatgtcaaataccatttgggg
gcgaatcgggagcttcaagacgctgaaacaaaatcagcgcgcattacgttagcgaacaac
ccgagccacttggaatttatcaatccgattgttgaaggcagcacaagagcggcacaggaa
acgcgaacacaaagcggatacccggtacaagatgaaacaaaatcgctggccattttaatc
catggagacgctgcattccctggggaaggaattgtagctgaaacattgaatttaagctct
ttaaaagggtatcaagtaggcggtgcgattcatattatcgccaataacatgatcggattc
acaacagaaagcgctgaatccagatcgacaaaatatgccagcgacctggccaagggttat
gaaattccgattgttcacgtgaatgcggacgatcctgaagcttgtctttcagctgttaag
tttgcggtcgaataccgaaaaacattcaacaaggattttctgattgatttgatcgggtac
agacgctatggacacaacgaaatggatgaaccgtcaaccactcagccaatgctgtatgat
gctgtcagaaagcatccgaccgtcaaacaaattttcgctgaaaagctggtaaaagaaggc
gtggttaccgaggaagtcgttcaaaacatcgaaaaatcggtaacgaagcgcattgaggat
gcatatcagaaagttccgtctaaaaaggaacacactgcttgtgaaattgaacttccagag
cctgtatcaaacggtttcccagatgtggacacttcgattgattttgatgtgctccgcaag
ctgaatggcgaattgatcaactggccggagtcatttaatgttttcggcaagctaaagcgc
attttagaaagacgcgccaaggcgttcgatgatgacagaaaagtggaatggtctttggca
gaatcactcgcgtttgcttcaattttgaaagacggaacaccgattcgtttaacaggacag
gattccgagcgcggaacgttcgcccaaagaaaccttgtgcttcatgacagtgagacgggc
aaagaatttgtgccgcttcatcacttatctgactgcagcacatcatttgctgttcataac
agcccgctgtctgaaggatcggttctcggttttgaatacggctataacgtgcattcaccg
gaaacgcttgttttgtgggaagcacagtacggagattttgccaacgctgctcaagtgtat
tttgaccaatttatttctgccggacgcgcgaaatggggccaaaaatccggattagtcatg
ctgctcccgcacggttacgagggacaggggcctgagcactcaagcggaagaattgagcga
ttcctgcagcttgcagcggaaaacaactggacggttgccaacctgacaagcgcggcacag
tatttccatattttaagaagacaggctaaaatgctgcttcgtgaagaaatcagaccgctc
gtcattatgacgccgaagagccttcttcgcaacccaaatacggtgtcggaagtgcaggag
ctcagcgaaagccgcttccagcctgtttatgaacagtcgggactttctcatgactatgaa
aaagtaaccagacttgtattatccagcggtaaagtgtctatagacattagcgatcatttt
aataagttagaagacggtaaagagtggcttcacattgcgagaatcgaacagctgtatcca
ttcccggcaaaaggagtcaaagaattatttgcaaaacttccgaacctgaaagaaatcgtt
tgggtgcaggaagagccgcagaacatgggggcttggggttatatcagcccgtatttgaca
gagattgcaccagagggagtaagcgttcaatatattggacgaagaagacgatccagccct
gcagagggagatccgacagttcataaaaaagaacaggaacgtattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system