KEGG   Bacillus sp. BS34A: BS34A_22280
Entry
BS34A_22280       CDS       T03833                                 
Name
(GenBank) hypothetical protein
Organism
bacl  Bacillus sp. BS34A
SSDB
Motif
Pfam: DUF4371 DUF982
Other DBs
NCBI-ProteinID: CEJ77642
LinkDB
Position
I:complement(2184672..2184866)
AA seq 64 aa
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WPKQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atgattcaagggttttataaagatcagaaacttcatcttctagaagatcctatgcagcag
tacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagattcacagatgttgaagaggctaaaaaactccttggagaaggg
tggccgaaacaatag

DBGET integrated database retrieval system