KEGG   Bacillus sp. BS34A: BS34A_23730Help
Entry
BS34A_23730       CDS       T03833                                 

Definition
(GenBank) hypothetical protein
Organism
bacl  Bacillus sp. BS34A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LETM1
Motif
Other DBs
NCBI-ProteinID: CEJ77787
LinkDB All DBs
Position
I:complement(2290546..2290902)
Genome map
AA seq 118 aa AA seqDB search
MISTSNYDVTKDPKFLAFCSLATEGYGQNNTQQSSIGFNEFCEKLEKNAIVKPENKKSTL
DLNKSLEDWKLRFTAGGNLSTMDSQVLDVIKKAYNLGMVNKDNMLLRNEAINAYRNSI
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtacttctaattatgatgtaactaaagatccaaaattcttagctttttgtagc
ttagcaacagaagggtatggacagaacaatactcagcaatcttcaataggttttaacgag
ttttgcgaaaaacttgagaaaaatgcgatcgttaaacccgagaataaaaaaagcacgctt
gatttgaataagtctttagaagactggaaattgagatttactgcaggcggaaacctttct
acaatggattcgcaggtattagatgttatcaaaaaagcttataacttaggcatggttaat
aaagataatatgctattacgaaatgaagcaattaatgcttatagaaattctatttaa

DBGET integrated database retrieval system