KEGG   Bacillus sp. BS34A: BS34A_29540
Entry
BS34A_29540       CDS       T03833                                 

Gene name
levD
Definition
(GenBank) PTS system fructose transporter subunit IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00051  Fructose and mannose metabolism
bacl02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BS34A_29540 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BS34A_29540 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacl02000]
    BS34A_29540 (levD)
Enzymes [BR:bacl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BS34A_29540 (levD)
Transporters [BR:bacl02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BS34A_29540 (levD)
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: CEJ78354
LinkDB
Position
I:complement(2780406..2780846)
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHE
VLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSLREHLALKDLLNNLKAMS
QQSFQVCSEHLEKVKTANQDTREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgattgcagtgccgtttttcaaaggggaagga
atacaaacgctgcaagaaaaatatcatcaggcgctcaaggatatcccggaagaacatgaa
gtgctttttttagtcgatatttttggagggacgccatataacgcggcagcttcctttatt
gctgaggatcaaagaatggatatggctgccggcgtaaacctgccgattctgctggaggta
ttaagcctgagagaacatctggctctcaaagatttgctgaacaacttaaaagcaatgagt
cagcaaagctttcaagtgtgcagtgaacatttagaaaaagtaaaaacagccaatcaagat
acaagagaggatgaattatga

DBGET integrated database retrieval system