KEGG   Bacillus sp. BS34A: BS34A_31020Help
Entry
BS34A_31020       CDS       T03833                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00020  Citrate cycle (TCA cycle)
bacl00190  Oxidative phosphorylation
bacl00650  Butanoate metabolism
bacl01100  Metabolic pathways
bacl01110  Biosynthesis of secondary metabolites
bacl01120  Microbial metabolism in diverse environments
bacl01130  Biosynthesis of antibiotics
bacl01200  Carbon metabolism
Module
bacl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BS34A_31020 (sdhB)
   00650 Butanoate metabolism
    BS34A_31020 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BS34A_31020 (sdhB)
Enzymes [BR:bacl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BS34A_31020 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BS34A_31020 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_18 Fer4_2 Fer4 Fer4_16 Fer4_15 Fer4_4 Fer4_13 Fer4_21 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CEJ78495
LinkDB All DBs
Position
I:complement(2923582..2924343)
Genome map
AA seq 253 aa AA seqDB search
MSEQKTIRFIITRQDTADSTPYDEEFEIPYRPNLNVISALMEIRRNPVNVKGEKTTPVTW
DMNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFDSL
KKVKAWIPIDGTYDLGPGPRMPEKRRQWAYELSKCMTCGVCLEACPNVNSKSKFMGPAPM
SQVRLFNAHPTGAMNKSERLEALMDEGGLADCGNSQNCVQSCPKGIPLTTSIAALNRDTN
LQAFRNFFGSDRV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaaaaaaccatacgatttattatcacacgtcaagatacagctgacagcacg
ccttatgatgaagaatttgagattccataccgcccgaatctgaacgtcatttccgctctg
atggaaatccgccggaatccggttaatgtcaaaggtgagaagacaacccctgtcacatgg
gatatgaactgtcttgaggaagtatgcggcgcatgttcaatggttataaacggaaaaccc
cgccagtcttgtacggcgcttattgaccagcttgaacagccaatccgtttaaaaccaatg
aaaacattcccagtcgttcgtgatttgcaggttgatcgcagcagaatgtttgattcattg
aaaaaagtaaaagcgtggataccgattgacggtacgtacgatttaggaccggggccgaga
atgccggaaaaacgtcgtcaatgggcatatgaattatcaaaatgcatgacatgcggcgtc
tgcctcgaagcttgcccgaatgtgaacagcaaatcgaagttcatggggcctgcaccgatg
tcgcaagtccgcctgtttaacgcgcatccgacaggcgccatgaataaatctgaacgatta
gaagcattaatggatgaaggcggccttgcagattgcggcaactcgcaaaactgtgttcaa
tcctgtccgaaggggattccgcttaccacttcgattgcagccttgaatagagatacaaac
ttacaagcgttccgcaatttcttcggaagcgacagagtataa

DBGET integrated database retrieval system