KEGG   Bacillus sp. BS34A: BS34A_31030Help
Entry
BS34A_31030       CDS       T03833                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00020  Citrate cycle (TCA cycle)
bacl00190  Oxidative phosphorylation
bacl00650  Butanoate metabolism
bacl01100  Metabolic pathways
bacl01110  Biosynthesis of secondary metabolites
bacl01120  Microbial metabolism in diverse environments
bacl01130  Biosynthesis of antibiotics
bacl01200  Carbon metabolism
Module
bacl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BS34A_31030 (sdhA)
   00650 Butanoate metabolism
    BS34A_31030 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BS34A_31030 (sdhA)
Enzymes [BR:bacl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BS34A_31030 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BS34A_31030 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored Not3 DAO DUF844 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CEJ78496
LinkDB All DBs
Position
I:complement(2924346..2926106)
Genome map
AA seq 586 aa AA seqDB search
MSQSSIIVVGGGLAGLMATIKAAESGMAVKLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPSIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDDRTCRGIVAQNLT
NMQIESFRSDAVIMATGGPGIIFGKSTNSMINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGDDPRKLPMKIFPAVHYSMGGLWV
DYDQMTNIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAVKYVNGLESSAEDM
SSSLFDAHVKKEEEKWADIMSMDGTENAYVLHKELGEWMTANVTVVRHNDKLLKTDDKIQ
ELMERFKKININDTTKWSNQGAMFTRQFSNMLQLARVITLGAYNRNESRGAHYKPDYPER
NDDEWLKTTMAKHVSPYEAPEFEYQDVDVSLITPRKRDYSKKKVAK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaagcattatcgtagtcggcgggggtcttgccggcctcatggcgacaatt
aaagcagcggaatcaggaatggcggttaaattgttttccatcgttcctgtcaaacgttct
cattcagtttgtgcgcaaggcggcataaacggagcggtcaatacaaaaggggaaggtgac
tctccgtgggaacattttgatgacacggtatacgggggagactttcttgccaaccagccg
ccggtcaaggcgatgtgtgaagcggcgccttcgatcatccacttattagaccggatgggc
gtcatgtttaaccggacgcctgaaggcctgcttgatttccgccgattcgggggtacacag
caccacagaactgcttatgctggtgcgacgacgggacagcagctgctttacgcactggac
gagcaagtgcgcagatacgaagttgcgggtctggtcacaaaatacgaaggctgggaattc
cttggcgctgttttagatgatgacagaacctgccgcggaattgttgcacaaaacctgaca
aacatgcaaattgaatccttccgttcagacgctgtcattatggcgacgggcggaccggga
atcatctttggaaaatcaacgaactccatgattaatacaggatctgctgcgtcaatcgtt
tatcagcagggagcgtattatgcaaacggagaattcattcaaatccacccgacagccata
ccgggcgatgacaaactaagactgatgagtgaatcagcgcgtggtgaaggcgggcgcgtg
tggacatataaagacggcaaaccatggtatttcctggaggaaaaatatccggcatacgga
aacctggtgccgcgtgatattgcgacacgcgaaatatttgatgtgtgtgtgaaccagaag
ctcggtattaacggtgaaaacatggtatatctcgatctgtctcataaagatccgaaagag
cttgatattaagcttggcggcatcattgagatttatgagaaattcatgggagacgacccg
cgtaagcttccaatgaaaatcttcccggcggtccattattctatgggcggtttatgggtg
gattacgatcaaatgacaaatatccctggactgtttgcggctggggaatgtgattattct
atgcacggcggcaaccgcttgggagcgaactccctgctgtctgcgatttacggaggcatg
gtggccggtccgaatgcggtgaaatatgtaaacggcttagaatcttcagcggaagacatg
tcttcatctttattcgacgctcacgttaagaaagaagaagaaaaatgggctgatattatg
agtatggacggaaccgaaaatgcctatgttcttcacaaagagctcggtgagtggatgacg
gcgaacgtaacggttgtccgccataatgacaagcttttgaaaacggatgacaaaattcag
gagttaatggagcgcttcaaaaagatcaacatcaatgacacgacaaaatggagcaaccag
ggagcgatgttcacacgccagttctcgaacatgcttcagcttgcgagggtgattaccctt
ggcgcatacaaccgtaatgaaagccggggcgcccattataaaccggattatcctgaacgt
aatgatgatgaatggctcaaaacaacaatggctaaacatgtaagcccgtatgaagcgccg
gaatttgagtatcaggatgtcgatgtatcactgataacgcctcggaaacgggattactcg
aagaagaaggtggcgaaataa

DBGET integrated database retrieval system