KEGG   Bacillus sp. BS34A: BS34A_35920Help
Entry
BS34A_35920       CDS       T03833                                 

Gene name
yusT
Definition
(GenBank) HTH-type transcriptional regulator YusT
  KO
K21959  LysR family transcriptional regulator, cell division regulator
Organism
bacl  Bacillus sp. BS34A
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacl03000]
    BS34A_35920 (yusT)
Transcription factors [BR:bacl03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    BS34A_35920 (yusT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: CEJ78949
LinkDB All DBs
Position
I:3395901..3396788
Genome map
AA seq 295 aa AA seqDB search
MESGDLRVFQMVAREGTITKAALQLGYVQSNVTARIQQLEAELGTTLFLRHNRGMTLSAS
GKLLLDYANKIIGLLDEASKALSSSAEPSGPLMIGCTQTTAAVRLPKLLASYYEEHPNVQ
LSLTTGHTQFLLDKVLRYELDGAFIGCECHHPELESYPAFEEEPVVVSAASVPDVEEAIT
KPILVYSTGCSYRETLEKWLRSVGVTQPVIMEFGTLEAIIGGVTAGLGISLLPRTVVQKH
EAEGSIRLYPLPEALSQMKTEFIVRKDSFISSALRTFMDSFTPVKTAESQKSSLL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcggagatttacgtgtgtttcaaatggtagctcgtgaagggaccattacgaaa
gcagccctgcagcttggctatgtacaatcgaatgtcacggccagaattcaacaattggaa
gctgagctgggtaccacactgtttttgcgccataatcggggcatgacactttctgcaagc
ggaaaattgctgctggactacgcaaataaaattataggccttcttgatgaagcgtctaaa
gcgctctcatcctccgcagaaccaagcgggccgcttatgatcggctgcactcagacaacc
gccgcggtaaggcttccaaagcttctggcatcttattatgaagaacatccaaacgtccag
ctgtctttaacaacaggacatacgcaatttctccttgataaagttcttcgttatgaattg
gatggcgcgtttatcggatgcgaatgccatcatcctgagctcgaatcctatcctgcgttt
gaggaagaaccagtagttgtttcggctgcctccgtgcccgatgttgaggaagccatcaca
aagccgattctcgtttacagcacaggctgttcgtatcgagaaacacttgaaaaatggctg
cgttccgtcggtgtcacacagccggtcattatggaatttgggacgcttgaagcaattatc
ggcggggttacagcaggtcttggcatctcgttgctgccaagaacggttgtgcagaaacat
gaagcagaaggatcaattcgattgtacccgctgcctgaagctctcagccagatgaaaaca
gagtttattgttcgaaaagattcgtttatcagcagcgcgctgagaacctttatggattcc
tttacgccagttaaaacggctgaatcacaaaaaagcagtctgctataa

DBGET integrated database retrieval system