KEGG   Bacillus sp. BS34A: BS34A_37960Help
Entry
BS34A_37960       CDS       T03833                                 

Gene name
hisI
Definition
(GenBank) histidine biosynthesis bifunctional protein HisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00340  Histidine metabolism
bacl01100  Metabolic pathways
bacl01110  Biosynthesis of secondary metabolites
bacl01230  Biosynthesis of amino acids
Module
bacl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BS34A_37960 (hisI)
Enzymes [BR:bacl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BS34A_37960 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BS34A_37960 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: CEJ79147
LinkDB All DBs
Position
I:complement(3600944..3601573)
Genome map
AA seq 209 aa AA seqDB search
MKQADELRFNEDGLIPAIVQDAASKEVLTLAYMNKESYEKTLETKETWFYSRSRQALWHK
GETSGNTQAVKGIRYDCDQDALLVLVEPSGPACHTGSYSCFTKEQTEEQAADRFGIMNEL
ERVIAERQAEMPEGAYTTYLFREGVDKILKKVGEEASEVIIAAKNRDHEELKWEAADLLY
HLLVLLREQSLPLDDVLDVLKKRHSEIEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcagatgaactgcgttttaacgaggacggattaattcctgctatcgtgcag
gatgcggcaagcaaagaagtgctgacacttgcgtatatgaacaaggaatcgtacgaaaaa
acgctggaaacgaaggaaacatggttttacagccgctcacgccaagcgttatggcataaa
ggagaaacctcagggaacacgcaagccgtcaaaggtatccggtatgactgcgatcaagac
gcgctgctcgtactcgtagaaccgtcaggcccggcatgccacactggcagctacagctgt
tttacaaaggaacaaacagaagaacaggccgcggaccgattcggcatcatgaacgaactg
gagcgggtgatcgcggaacgccaagcggaaatgcctgaaggagcttacaccacgtacctc
ttccgtgaaggcgtcgataagattttgaaaaaagtcggagaagaagcatccgaagtcatc
atcgccgcgaaaaaccgggatcatgaggaactcaaatgggaagcggcagacctgctgtat
cacctgcttgtcctgctcagagaacaatccctgccgctggatgatgtgcttgacgtattg
aaaaaacgccattctgagattgaagagtaa

DBGET integrated database retrieval system