KEGG   Bacillus sp. BS34A: BS34A_38450Help
Entry
BS34A_38450       CDS       T03833                                 

Gene name
fliD
Definition
(GenBank) flagellar hook-associated protein 2
  KO
K02407  flagellar hook-associated protein 2
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BS34A_38450 (fliD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bacl02035]
    BS34A_38450 (fliD)
Bacterial motility proteins [BR:bacl02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BS34A_38450 (fliD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliD_C FliD_N Flagellin_IN DUF948 YojJ
Motif
Other DBs
NCBI-ProteinID: CEJ79196
LinkDB All DBs
Position
I:complement(3650919..3652415)
Genome map
AA seq 498 aa AA seqDB search
MVTRITGLASGMDIDDIVSKLMQTERAPLDKLTQKKQTLEWQRDSYREVNSKIKELQDYM
SKNTLTYPSTYQSKTVTSSNESVLTATGSVSAPNSSSTVEVASLATAATYKANNYTGYTQ
GDYNLAFNVVAPGETTAKTVNISVTSADTIDNVISKLNSSDLGVSAFKDKIWNGTEYVET
IAFSSKATGAGGSIQAADSATADFMSGQLGFSLDADNKLTAYKEGTNAKVTINGFEMEKL
TNNFTVNGVTYSIKNTTAATGPVTTSVSTDVDGIYNQIKEFVDKYNELVDSLNEKLKEEK
YRDYTPLTSEQKEAMSDKEVELWEEKAKSGLLRNDSSISTGTNQMRTDFYTQVNADGKTY
QLTEFGITTSSAYQLRGHLEINEEKLKAKIAEDPQGVANLFTSGTNDSNYSDKGIMKRIT
NTLRSTVKSIEAKAGNSTMGASSYSIGKNLNSISTEITDMQDRLNTIENRYYSKFSAMDS
AIQKMNEQASYLSQLLVQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtcacaagaataacaggtctggcgtcaggaatggatatagatgatatcgtatcaaag
ctgatgcagacagaaagagcgccgcttgataagctgacacaaaaaaagcagactcttgaa
tggcagcgtgacagctatcgtgaagtaaactcaaaaataaaagaattgcaagattatatg
tctaaaaatacgttgacatatccgagcacgtatcagagcaaaactgtgacaagctctaat
gagtctgtgttaactgctacaggaagcgtaagtgcgccaaattcttcgtctactgttgaa
gtggcgagcttggcaactgcagcaacgtataaggcaaacaattatacgggatacacacaa
ggcgattacaatttggcatttaacgttgttgcgcctggcgaaacaacagcaaaaacagtg
aacattagtgtgacgagtgccgatacgattgataatgtgatttctaaacttaacagctca
gatctaggagtatcagcatttaaagataaaatttggaatggtacagagtacgtagaaacg
attgcgttttcttctaaagcaacaggtgcaggaggaagcatacaggcagcagactctgct
acagctgactttatgtccggtcagcttggtttttctttggatgctgataataagcttact
gcttacaaagaaggcacaaatgccaaagtcacaatcaacggctttgaaatggagaagctg
acaaacaatttcacggtgaatggtgttacttattcgattaaaaatacaactgcagccaca
ggccctgttaccacatctgtttctactgatgttgatgggatttataaccaaatcaaagag
tttgtagataaatacaatgaactggttgacagcctgaatgaaaagctgaaagaagaaaaa
taccgagactatacgccactcacgagtgaacaaaaagaagccatgtccgataaagaggta
gagctctgggaggagaaggcgaaaagcggattgctgagaaacgattcaagcatcagcact
ggcacgaaccaaatgcggactgacttttatactcaagtgaatgcggatgggaaaacctat
caattaactgaatttggcatcacaacttcaagtgcttaccaactgcgagggcacttagag
attaacgaagagaaattgaaagcaaaaatagcagaagatcctcaaggagttgctaatctt
tttacaagtggaacaaatgatagtaactatagcgataaaggtattatgaagcggattact
aatacacttagaagtactgtgaaaagtattgaagctaaagctgggaactcgacaatggga
gctagtagctattccattggaaaaaatttaaactcgataagtactgaaataactgatatg
caggacagattgaataccatagaaaaccgctattattcaaaattcagtgcaatggattct
gcgattcaaaaaatgaacgaacaagcgtcctatttatcacagcttcttgtacaataa

DBGET integrated database retrieval system