KEGG   Bacillus sp. BS34A: BS34A_39150Help
Entry
BS34A_39150       CDS       T03833                                 

Gene name
alsR
Definition
(GenBank) HTH-type transcriptional regulator AlsR
Organism
bacl  Bacillus sp. BS34A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_20 HTH_24
Motif
Other DBs
NCBI-ProteinID: CEJ79266
LinkDB All DBs
Position
I:3729506..3730414
Genome map
AA seq 302 aa AA seqDB search
MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKRFVELTAA
GEIFLNHCRMALMQIGQGIELAQRTARGEQGLLVIGFVGSATYEFLPPIVREYRKKFPSV
KIELREISSSRQQEELLKGNIDIGILHPPLQHTALHIETAQSSPCVLALPKQHPLTSKES
ITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMT
FVPSSAKKLFNLDVTYRKMDQIQLNAEWVIAYRKDNHNPLIKHFIHISNCQQTRTKESDA
GT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggagcttcgccatcttcaatactttatcgcagtagccgaagagcttcatttcggaaag
gctgcccggcggctgaacatgacgcagcctcctctcagccagcagatcaaacagctggag
gaagaagtcggagttacgcttctgaaaaggacaaaacgatttgtcgagcttaccgcagca
ggagaaatctttttaaatcattgccgcatggcattgatgcaaatcggacaaggaattgaa
ctggcacagcggacggcccgcggcgagcaaggccttctcgtaatcggttttgtcggatca
gctacatatgaatttctgccgccgattgtccgggaatatcgtaaaaaattcccatctgtg
aaaatagaactgcgtgaaatatcctcgtctaggcagcaggaggagctactaaagggcaac
attgatattggtatacttcatcctcccttacagcatacagctttacatatcgaaaccgcc
caaagcagcccttgtgttttagctttgcctaagcaacacccattgacttctaaggaatca
attacgattgaggatttaagagatgaaccaattattactgttgctaaagaagcatggcct
actctatacatggattttattcagttctgtgaacaagcgggcttcagacccaacattgtc
caggaagccacagaatatcaaatggtgattggtttagtcagtgccggaattggtatgaca
tttgttccttcctcggccaaaaaattatttaatttggatgttacttatcgaaaaatggac
caaatacagcttaatgcagaatgggttatcgcttaccgcaaagacaatcataatccgctt
ataaagcattttattcatatttcaaattgtcagcagacaagaactaaagagagtgatgca
ggtacatga

DBGET integrated database retrieval system