KEGG   Bacillus sp. OxB-1: OXB_0415Help
Entry
OXB_0415          CDS       T03635                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
baco  Bacillus sp. OxB-1
Brite
KEGG Orthology (KO) [BR:baco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OXB_0415
Enzymes [BR:baco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     OXB_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored HI0933_like Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_7 DAO NAD_binding_8 Thioredoxin_4 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: BAQ08887
UniProt: A0A0A8JEX9
LinkDB All DBs
Position
complement(420533..422062)
Genome map
AA seq 509 aa AA seqDB search
MILDADIKAQLDQYLKMMEGDVLLKVSAGDDKVSREMLELVNELATMSSRIEVERTELER
TPSFSVNRIGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVDKKVIEQVKKIEDKLHF
ESYISLSCQNCPEVVQALNLMSVLNPNITHTMIDGAAYKEEVESKNILAVPTVYLNGEPF
TNGRKTIEEILAELGSGPDASEFADKDPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQILDTAAIENFISVNRTEGPKLAASLEEHVKDYNIDVMNLVRAKRLEKKDLIEIELE
NGAVLKSKSVILSTGARWRNIGVPGEAEFRNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGITNHVTVLEFAPELKADSVLQDRLYSLPNVTVVKNAQTKEITGTDSVNGITY
IDRDSGDEHHIELAGVFVQIGLVPNTDWLGDAVERNKFGEIVVDKRGATNVPGVFAAGDC
SDSAYKQIIISMGSGATASLSAFDYLVRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaagcacaattagaccaatatcttaaaatgatggagggc
gatgtgctgctcaaagttagcgcgggagatgataaggtttcgcgtgaaatgctggaactt
gtgaatgaactggccaccatgtcatcacgcattgaagtggagcgtacagagttggaaaga
actccgagctttagtgtcaatcgcatcggtgaggatactggagtcgttttcgctggtatt
ccgcttggacatgaattcacttcactcgtccttgctctattgcaagtgagcggcagggcg
ccaaaagtggataagaaagtcattgagcaagtgaagaagatcgaggataagcttcatttt
gaatcctatattagcttgagctgtcaaaactgcccggaagtggtacaggcacttaacctc
atgagcgtattgaacccaaacattacgcacacgatgattgacggcgcagcatataaagaa
gaagtggaaagcaaaaatattcttgctgtcccgactgtatatttgaatggggagccgttc
acaaacggtcggaagacaatcgaagaaatcttggctgaactcggaagcggcccggacgct
tcagagtttgccgataaagatccatttgacgtactcgttgtcggcggaggaccagctggt
gcgagtgctgcgatctacgcggctcgtaaagggattcgtacaggaattgtcgctgagcgt
ttcggcggtcagattttggatacggctgcaattgagaacttcattagtgtcaatcgcacg
gaaggtcctaaactggcggctagtcttgaggagcacgtgaaagactataatatcgacgtg
atgaatttggtacgtgcgaaacgtttggagaagaaagatctcattgaaatcgaattggaa
aacggtgctgttctgaagagtaaatccgtcatcctttcaacaggagcgcgctggcgcaat
atcggtgtaccgggcgaggcggaattcagaaacaaaggggttgcctactgtccgcattgt
gacggtccgctattcgaaggcaaggatgttgcagtcatcggtggaggtaactctggtatt
gaggcggcaatcgaccttgcgggaatcaccaaccatgttaccgtccttgaattcgcacct
gaactgaaagccgattctgttttgcaagatcgcctgtacagcttgccgaatgtcactgtc
gtgaaaaacgctcaaacaaaggaaatcaccggtacggatagcgtaaacggaattacgtat
attgatcgtgattcaggtgacgaacaccatatcgagctagctggtgtcttcgttcaaatc
ggtctagtccctaacacggattggctcggcgacgcagtggaacgcaataaattcggtgaa
attgttgtcgataagcgtggcgccacgaacgtcccaggcgtatttgctgcgggagactgc
tccgatagcgcatataaacaaatcattatttcaatgggatccggagcgactgcatcacta
agcgcattcgattatctcgttcgaaactaa

DBGET integrated database retrieval system