KEGG   Bacillus sp. OxB-1: OXB_0711Help
Entry
OXB_0711          CDS       T03635                                 

Definition
(GenBank) elongation factor tu
  KO
K02358  elongation factor Tu
Organism
baco  Bacillus sp. OxB-1
Brite
KEGG Orthology (KO) [BR:baco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:baco03012]
    OXB_0711
   03029 Mitochondrial biogenesis [BR:baco03029]
    OXB_0711
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:baco04147]
    OXB_0711
Translation factors [BR:baco03012]
 Eukaryotic Type
  Elongation factors
   OXB_0711
 Prokaryotic Type
   OXB_0711
Mitochondrial biogenesis [BR:baco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    OXB_0711
Exosome [BR:baco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OXB_0711
  Exosomal proteins of breast cancer cells
   OXB_0711
  Exosomal proteins of colorectal cancer cells
   OXB_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: BAQ09183
UniProt: A0A0A8JEJ4
LinkDB All DBs
Position
complement(704865..706052)
Genome map
AA seq 395 aa AA seqDB search
MGKEKFDRSKEHANVGTIGHVDHGKTTLTAAIATVLSKRMGGEAKSYADVDNAPEEKERG
ITINTSHIEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEIRDLLSEYEFPGDDIPVIKGSALKALE
GEAEWEEKIVELMNAVDEYIPTPPRDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKVG
DVVDIVGIVDEAKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVARDDIQRGQVLAKPGSI
VPHTKFTSEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGVIELPEGVEMVMPGDNVEM
TVELIAPIALEEGTKFSIREGGRTVGAGVVATIQA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagaaaaatttgaccgctccaaggagcacgctaacgttggtacaatcggtcac
gttgaccatggtaaaacaactctaactgctgcaattgcaacagttctttcaaaaagaatg
ggtggagaagcgaaatcttacgctgacgtagataacgcgccagaagaaaaagagcgtgga
atcacgatcaatacttcacacatcgagtacgaaactgacaaacgtcactatgcacacgtt
gactgcccaggtcacgctgactacgttaaaaacatgatcactggtgctgctcaaatggac
ggcggtatcctagtagtatctgctgctgacggcccaatgccacaaactcgtgagcacatc
cttctttcacgtcaagtaggtgttccttacctagttgtcttcatgaacaaatgtgacatg
gtagacgacgaagaacttcttgaactagttgaaatggaaattcgcgaccttctatctgag
tacgagttccctggcgatgacattccagttatcaaaggttctgctctaaaagctcttgaa
ggtgaagctgagtgggaagagaaaatcgttgaattgatgaacgctgttgacgagtacatc
ccaacaccaccacgtgacactgaaaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtacagtagcaacaggccgtgttgagcgtggacaagttaaagtcggc
gacgtagtcgacatcgttggtatcgtagacgaagcgaaatctacaactgttacaggtgta
gagatgttccgtaaacttcttgactatgcagaagctggagacaacatcggtgcacttctt
cgtggggtagcacgtgatgacatccaacgtggacaagttcttgcaaaaccaggttcaatc
gttccacacactaaatttacttctgaagtatatgttctttctaaagaagagggtggacgt
cacactccattcttctctaactaccgtccacagttctacttccgtacaacggacgtaact
ggcgttatcgaacttcctgaaggcgtagaaatggttatgcctggggataacgttgaaatg
acagtagaattgatcgctccaatcgctcttgaagaaggtacaaaattctcaatccgtgag
ggtggccgtactgtaggcgctggcgttgtagcaacaatccaagcttaa

DBGET integrated database retrieval system