KEGG   Bacillus sp. OxB-1: OXB_1318Help
Entry
OXB_1318          CDS       T03635                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:baco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OXB_1318
Enzymes [BR:baco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     OXB_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAQ09789
UniProt: A0A0A8JJ69
LinkDB All DBs
Position
1345693..1347171
Genome map
AA seq 492 aa AA seqDB search
MKLTNFINGAWQEENGADFAPVHNPANGQELAKVRLSTKEDVDRAVAAAKSAQRQWALVP
APKRADYLYEIGRLMKEKKEHLSRVLTKEMGKVIEEARGEVQEGIDMAYYMAGEGRRLVG
ETVPSELQNKFAMSVRAPIGVVGLITPWNFPVAIATWKSFPALVAGNTFVWKPASETPMM
AYEMALIFEESGLPAGVANIVFGTGAEVGTALIEHPDVRVISFTGSTETGRRVAELGGRH
LKKVSLEMGGKNAVIVMDDADLELAVEGILWSAFGTAGQRCTACSRVILHKDVKEELEQK
LLASMEGLTIGDGLDETVKIGPVINRQALEKITRYIAIGQEEGAKLLAGGKVAVEGDLSE
GHYMEPTLFTDVKWDSRLAQEEIFGPVVSLITVADLDEAIEVNNSVKYGLSSSIFSQDVN
KIFRAQRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWKSVYVDF
SGKLQRAQIDTE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgactaattttatcaatggtgcatggcaggaggaaaacggcgcagattttgca
ccggtgcacaacccggcgaacgggcaagagctggccaaggtgaggttgtcgacgaaagag
gacgtggatcgggcagtggcagctgcaaaatcggcccaacggcaatgggcgctcgttccg
gctccgaaacgggcggattatctgtacgaaattggcaggctgatgaaagaaaagaaggag
catctctcccgagtattgacgaaagagatggggaaagtgatcgaggaagcacgcggggaa
gtgcaggaagggatcgacatggcctactatatggcgggtgaaggaaggcgcttggtcgga
gaaaccgtaccgtccgagcttcagaataaattcgcgatgagcgtccgggcccccatcggt
gtcgtcggcctgatcacaccgtggaatttcccggtcgccattgcgacatggaaatccttt
cccgccctcgtcgcagggaatacgttcgtctggaaacctgcgagtgaaacaccgatgatg
gcctatgaaatggccttgattttcgaagagtccggcctgcccgcgggagtggccaatatt
gtgttcggcaccggtgcggaagtcggcacggcgttaatcgagcatccggatgtccgggtc
atctccttcactggttcgacggagaccggtcgccgtgtggcggaactgggtgggcgtcat
ttgaagaaagtgtcgcttgaaatgggagggaaaaatgcggttatcgtcatggatgacgcc
gatttggagctcgctgtcgaaggaattttatggagcgcttttggcacggctggtcaacgt
tgcaccgcatgcagccgggtcatattgcataaagatgtgaaagaggagctggagcagaaa
ctcttggcctctatggaaggactcacaatcggcgatggattggacgaaacagtgaaaatc
ggtccggtcatcaatcggcaggcgttggagaagattacccgctatatcgctattggacaa
gaagaaggtgccaagctgctagcgggcgggaaagtggcggttgagggagatttgtcggag
gggcattatatggagccgacgctgttcaccgatgtgaaatgggatagccgattggctcag
gaggaaattttcggacctgtcgtttcactgattacggtggcggatctggatgaggcgatt
gaagtgaacaatagtgtgaaatacggattgtccagctccatcttctcacaggacgtcaat
aaaatcttccgggcgcaacgcgatttggatacgggaatcgtttacgtcaatgcagggact
acaggagcggaaatccatctgccgttcggcgggacgaaagggaccggaaatggccatcgg
gactcgggggttgcggcattggacgtatttacggaatggaaaagcgtttacgtggacttc
agcgggaaattgcagcgtgcgcagattgatacggaataa

DBGET integrated database retrieval system