KEGG   Bacillus sp. OxB-1: OXB_1691Help
Entry
OXB_1691          CDS       T03635                                 

Definition
(GenBank) protein degv
Organism
baco  Bacillus sp. OxB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegV
Motif
Other DBs
NCBI-ProteinID: BAQ10162
UniProt: A0A0A8JIG1
LinkDB All DBs
Position
1764154..1764999
Genome map
AA seq 281 aa AA seqDB search
MKTAIVTDSTAYLPAHLIEELDIRIIPLTVTLEGQAYEEEIGIATTDFYNKVRGDGPLPK
TSQPPVGRFVELFNELKQDYDAIISIHLSSGISGTYAGAVQAGEMVDGVEVCAFDTEISC
YIQGFYVIRAAQLAKQGEKLDEIMAALNEMKQTTRAYFMVDDLSHLQRGGRLSGAQALIG
GLLQVKPILHFQDKVIVPFEKIRTRKKAMKRIADLLGEEATRMPLDACIIHGNCPEAAET
WRDELAARFPDVHFTISHFGPVIGTHLGEGAMGLGWTKRNG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaccgcaattgtgactgatagcacggcatacctgccggctcatttaatagaagaa
ttggatatccgaatcattccgctgacggtgacgctggaagggcaggcgtatgaggaagaa
atcgggattgcaacgaccgatttctacaataaagtgcggggggacgggccgttgccgaag
acgtcgcagccgccggtcggccggttcgtggagctgttcaatgagcttaaacaggactac
gacgccatcatttccatccatctgtctagcggcatcagtggcacgtatgctggggcggtg
caggcgggggagatggtcgatggggtggaggtctgcgcattcgacaccgaaatctcgtgt
tacatccaagggttttacgtcatccgcgcggcgcaactggcgaagcagggtgagaaactt
gacgaaatcatggccgccctgaatgaaatgaaacagacgacgcgtgcctatttcatggtg
gacgacttgtcgcatctgcagcgcggcggccgcttgtccggcgcacaagcacttataggg
gggcttctccaagtgaagccaatcctccattttcaggataaagtgatcgtcccgttcgaa
aagatccggacgcgcaaaaaagcgatgaaacggattgccgatctgctcggcgaagaggcg
acccgcatgccgcttgacgcgtgcatcattcatggcaattgtccggaagccgctgaaact
tggcgcgacgaattggccgcccgcttcccggacgtgcatttcacgatcagccattttggc
ccggtcatcggcacccatctcggggaaggcgcgatggggctcggctggacaaagcgaaat
ggctaa

DBGET integrated database retrieval system