KEGG   Bacillus sp. OxB-1: OXB_3335Help
Entry
OXB_3335          CDS       T03635                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00010  Glycolysis / Gluconeogenesis
baco00071  Fatty acid degradation
baco00280  Valine, leucine and isoleucine degradation
baco00310  Lysine degradation
baco00330  Arginine and proline metabolism
baco00340  Histidine metabolism
baco00380  Tryptophan metabolism
baco00410  beta-Alanine metabolism
baco00561  Glycerolipid metabolism
baco00620  Pyruvate metabolism
baco00625  Chloroalkane and chloroalkene degradation
baco00903  Limonene and pinene degradation
baco01100  Metabolic pathways
baco01110  Biosynthesis of secondary metabolites
baco01120  Microbial metabolism in diverse environments
baco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:baco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OXB_3335
   00053 Ascorbate and aldarate metabolism
    OXB_3335
   00620 Pyruvate metabolism
    OXB_3335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OXB_3335
   00561 Glycerolipid metabolism
    OXB_3335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OXB_3335
   00310 Lysine degradation
    OXB_3335
   00330 Arginine and proline metabolism
    OXB_3335
   00340 Histidine metabolism
    OXB_3335
   00380 Tryptophan metabolism
    OXB_3335
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OXB_3335
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OXB_3335
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OXB_3335
Enzymes [BR:baco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     OXB_3335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra DUF1542
Motif
Other DBs
NCBI-ProteinID: BAQ11804
UniProt: A0A0A8JPY7
LinkDB All DBs
Position
complement(3346020..3347447)
Genome map
AA seq 475 aa AA seqDB search
MRSHLKHFINGEWVESTGSNTIDVINPATEEVIGQISDGTTEDLDKAVAAARAAFPSFSQ
TTKEERIQLLNRIADEYEKRKSDIVEAITQELGSPLSMSEKSHYKMGLGHFRQAAKELES
FEFTERRGNTLIRKEAIGVSGLITPWNFPTNQTSTKLASAFAAGSTVVLKPSELTPFAAI
ILAEVFQAAGLPKGVFNLVNGFGEVVGNGISSHPDIDFVSFTGSGAVGQKISENAAKTIK
KVALELGGKSPLIILEDYDMKKAAKIAVSNVVFNSGQVCTAATRTLVPKSKHDEFIDAVK
EVLPDFRVGDPQDSKSFLGPLVSEKQYHRVQGYIEKGLEEGATLIAGGTGKPEGLEKGYF
VKPTVFTNVQNSMVIAQEEIFGPVMSILAYENLNEAIEIANDTIYGLAGYVIGEDVETVE
KVASSIRAGRIVVNGAPQDFSAPFGGYKQSGIGREWGDYGIEEYLEIKSVVGMPS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagccatctaaaacattttattaatggtgaatgggtcgaatccaccggttcaaac
acaattgacgtcatcaacccagctactgaggaagtgatcgggcaaatcagtgatggaaca
acagaagatcttgataaagccgttgcagcagcccgggccgcttttccttctttttcccaa
acaacaaaagaagagcgtattcaactattaaatcggattgctgatgaatatgagaagcgt
aaaagtgatatcgttgaagcgatcacacaagaattgggctcgccgctttcaatgagcgaa
aagtctcactacaaaatgggattgggacatttccgtcaagcggcaaaagaattggaaagc
tttgaatttaccgaaagacgcgggaatacgttaatacgcaaagaggcaatcggcgttagc
ggtctaattacaccatggaacttcccgacaaaccagacatccacaaagcttgcaagcgct
tttgccgctggaagcactgttgtgttaaaaccatctgagcttacaccattcgctgcaatt
attctcgctgaagtttttcaggctgctggcttaccaaaaggtgtctttaaccttgtaaat
ggttttggcgaagtcgtcggaaatggtatcagttctcacccagatattgattttgtatcc
tttaccggttccggagctgtcggtcaaaagattagtgaaaatgccgcgaaaacgatcaaa
aaagtagcactcgaactcggaggaaaatcaccacttattatactggaagactatgacatg
aaaaaagcggctaaaatcgcggtttcaaatgtcgttttcaactctggccaagtatgtaca
gcggcaacaagaacgcttgttccaaaatcgaaacacgatgaatttatcgatgctgtgaaa
gaagtcttgcccgactttcgtgttggcgatccacaagatagcaaaagtttcttggggccg
cttgtttctgagaaacagtaccatcgcgtacaagggtatattgagaaaggactggaagaa
ggtgctacactcattgcaggtggaaccggcaaaccagaaggcttggaaaaagggtacttt
gtaaaaccaaccgtatttacgaatgtgcaaaatagtatggtgatcgctcaagaagaaatc
tttggaccggtcatgtcaatcctagcttacgagaatcttaatgaagcgattgaaattgcc
aatgatacgatatatggattagcaggttatgttattggggaagatgtcgaaactgtggaa
aaggtcgcttcttccattcgagctggtcgtattgtcgtgaatggggcccctcaagatttc
tctgcaccatttggaggctataaacaatccggaatcggccgtgaatggggagactacggc
attgaagaatatttggaaattaaatcggtagtcggcatgccgtcataa

DBGET integrated database retrieval system