KEGG   Bacillus sp. Pc3: SB24_00485Help
Entry
SB24_00485        CDS       T03544                                 

Definition
(GenBank) enoyl-CoA hydratase
Organism
bacp  Bacillus sp. Pc3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AJC23727
LinkDB All DBs
Position
120712..121491
Genome map
AA seq 259 aa AA seqDB search
MGDCVLYSVCQETIGLITLNRPHAANSLSSEMIDHLQRVIEDIKNSPSIRCVILTGTGNT
FCAGADLKERAGMNHEQVKQSVRRIGETAASIEALPQPVIAALNGTAVGGGLELALACDI
RTAVSRAGLGLPETGLAIIPGAGGTQRLPRLIGPGAAKELIYTGRRLSAEEGKDMKLIEH
VCKADELMEKAKALAGRIAANGPIAVRQAKAAINKGLETDLNTGLEIERKAYEQVIPTLD
REEGLRAFKEKRPPEYKGK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggagattgcgtcttgtattccgtctgtcaagaaacaatcggtctgatcacgctgaac
cgcccgcatgcggccaactcgctgtcttcagaaatgattgatcacttacagcgtgtgatt
gaagacatcaaaaactcgccatccattcgttgtgtcattctcaccggcaccgggaacaca
ttttgcgccggtgctgatttaaaagaaagagcggggatgaatcatgaacaagttaagcaa
agcgtcaggcgtatcggtgaaacagccgcatccattgaagctctcccgcagccggtcatt
gcagcgctgaacggaaccgctgtcggaggaggccttgaactcgctctcgcctgcgatatc
agaacagccgtcagccgggcgggcctcggccttcctgaaacagggcttgcgatcattccc
ggagcgggcggaacgcagagactgccccggcttatcggccccggcgcggcaaaagaattg
atctataccggccgaaggctttctgccgaagagggaaaagacatgaagctgatcgagcat
gtttgtaaagccgatgaactaatggaaaaagcaaaagcactggccggccgcatcgccgct
aatgggccgatcgccgtcagacaagcaaaagccgcgataaacaagggtctggagacagat
ctcaatacagggctcgaaatcgaacgaaaagcatatgaacaagtcatccccacacttgac
agagaagagggcctgcgcgcttttaaagaaaaaagaccccctgaatacaaaggaaaataa

DBGET integrated database retrieval system