KEGG   Bacillus sp. Pc3: SB24_06090Help
Entry
SB24_06090        CDS       T03544                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00627  Aminobenzoate degradation
bacp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SB24_06090
Enzymes [BR:bacp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     SB24_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJC24772
LinkDB All DBs
Position
complement(1334253..1335710)
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLENRNPYTQKVITSFQKGTSDDVDAAYRAAALAKQE
WDKVNPFKKRAILEKAVSFIEEHEEAIIYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIDGKENRLYRIPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLRRSVEKAIEEGAVPVLSGRFSG
TVAEPVILKDVKPEMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHTANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatgggagc
agccggaacgtattggaaaacagaaatccttatactcaaaaagtcatcacctcattccaa
aaagggacgtctgatgacgtggatgcggcatatcgcgccgcggctcttgcgaaacaagaa
tgggacaaagtaaacccttttaaaaagcgggccattttggaaaaagccgtttctttcatt
gaagagcacgaagaagcgattatttacttaatcatggaggagcttggcggaacacggctg
aaggctgagtttgaaatcggacttgtcaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtccacgattgacggaaaagaaaacaggctgtac
agaatacccgccggagtcgtgggggtgatcagcccgtttaatttcccgtttttcctttcg
atgaaatctgttgcgccggcactcggcgcggggaacggcgtcgtgctgaagcctcatgaa
gaaacaccgatctgcggcggaacgcttatcgcgaaaatttttgaagcggccggcgtaccg
gacgggctgctgaatgttatcgtgacggatatcggggagatcggcgacagctttgttgag
catcccgtcccgcggataatctcatttacaggctcaaccggagtgggcagctatatcgga
cagcttgcggtcaaacactttaaaaaaccgctgttggagcttggcggaaacagcgcgctg
atcgtgcttgaggatgctgatcttgaatacgccgtcaatgcggccgtattcagccggttt
acgcatcaaggccagatctgtatgtcggcgaaccgcgtgctcgttcacacatctgtatat
gacaaatttacagagctttacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgatacggttatcggccctttaatcaatgagagacaggcggaaggtttgagacgg
tctgtcgaaaaagcgatagaagagggagcggttccggtgctgtccggccgattcagcgga
acggtcgctgagcccgtcattttaaaagatgtgaaacctgagatgagcattgcgaaggag
gagctgttcggaccggccgtctgcatcatgccgtttgaaacggaggatgaagcggtaagc
atcgcaaacgcgacaccgttcggtttaagcggagccgtgcatacggcaaacgttgagcgc
ggcgttgagtttgctaagcggatcgaaaccggcatgattcacgtcaacgatacgaccatt
aatgatgaaccgaacgtcgcgttcggcggcgagaagcaatcaggtctcggcaggctgaac
ggtgaatggagccttgaagaattcaccacgctgaaatggatttcggttcagcatgaaaaa
cggcaattcccatattaa

DBGET integrated database retrieval system