KEGG   Bacillus sp. Pc3: SB24_07290Help
Entry
SB24_07290        CDS       T03544                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00473  D-Alanine metabolism
bacp01100  Metabolic pathways
bacp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SB24_07290
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SB24_07290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bacp01011]
    SB24_07290
Enzymes [BR:bacp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SB24_07290
Peptidoglycan biosynthesis and degradation proteins [BR:bacp01011]
 Precursor biosynthesis
  Racemase
   SB24_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Big_11
Motif
Other DBs
NCBI-ProteinID: AJC24988
LinkDB All DBs
Position
complement(1566208..1567377)
Genome map
AA seq 389 aa AA seqDB search
MTTASFYRETWAEINLSAIKENVTHMKKHIGQNVHLMAVVKANAYGHGDLEAGKAALEAG
ASCLAVAILDEAISLRKRGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSATVPFHLKVDTGMNRLGVKTEEEIQSVLKILSQNPGLVCKGVFTHFATADEKNRDYFL
CQFDRFKTLIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQSEIPF
QLKPAFALHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTSVLI
GGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKEETITMDEIAGRLGTINYEVPCT
ISSRVPRMFLENESIMEVRNPLLQDNTSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagcatccttttacagagaaacgtgggcggaaatcaatctgtccgcgattaaa
gaaaatgtcacgcatatgaaaaaacacatcgggcaaaacgtccatctcatggcggttgta
aaggcgaacgcttacggacacggagatttggaagccggtaaagccgcgcttgaagcgggt
gcctcttgtcttgccgtagccatactggatgaagcgatttcattgagaaagcggggcatt
acagcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgag
tatgacgtaacactcacggggtattctgttgaatggcttcaggaagctgcgcgccacctc
gggagtgcgacagtgccgtttcatctgaaagtcgacaccggcatgaacagactcggagtc
aaaacggaggaagaaatccaaagcgtgttaaaaatcctcagccaaaatcccggtttagtc
tgtaaaggcgtattcacccactttgctaccgcggatgagaaaaacagagattatttcctc
tgccagtttgaccgctttaaaacattgatcgctccgcttcctttaaaagaattgatggtg
cactgcgcgaacagcgctgccggacttcgtcttaaaaagggcttctttaacgcggttcgt
ttcggcatcagtatgtacgggcttcgtccttctgctgacatccaaagcgaaattccgttt
caattaaagccggcttttgcgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatatacggcagagaaggatcaatggatcggaacg
gttcccatcggctatgcagacgggtggctccgcaagctgagcggcacgtctgtgctgatc
ggcggcaaacggatgaatatcgcgggaagaatctgcatggatcaattgatggtcgaatta
gatcaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaaggaagaaacg
atcacgatggatgaaatcgccgggcggcttgggacgattaattacgaggtcccttgtacc
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagataatacaagcaagtag

DBGET integrated database retrieval system