KEGG   Bacillus sp. Pc3: SB24_09330Help
Entry
SB24_09330        CDS       T03544                                 

Definition
(GenBank) heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
bacp  Bacillus sp. Pc3
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bacp03110]
    SB24_09330
Chaperones and folding catalysts [BR:bacp03110]
 Heat shock proteins
  HSP33
   SB24_09330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AJC25345
LinkDB All DBs
Position
complement(1973885..1974760)
Genome map
AA seq 291 aa AA seqDB search
MDYLIKAIAYDGKVRAYAARTTDMVNEAQRRHDTWPTASAAIGRTMTASLMLGAMLKGED
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPHVHFDLNEQGKLDVRRAVGTDGTLSVVK
DLGLRDYFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLL
PGTDEETISTIEKQLSQIEPISKLIQKGLTPEEILEEVLGQKPDVLETMPVKFHCSCSKD
RFETAILGLGKKEIQDMIEEDGKAEAVCHFCNEKYLFTKEELEELRDETTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttaattaaagcaattgcatatgacggtaaagtgcgggcttatgcagccaga
acgacagatatggttaatgaagcgcaaagaaggcatgacacgtggccgacggcatcagcc
gcaatcggccggacgatgacagcttctctgatgctcggagcgatgcttaagggtgaagat
aagctgacagtcaaaatagaaggcggcggcccgatcggagccattgtcgcagatgcgaac
gcaaagggtgaggtaagagcatacgtatcaaacccgcacgttcattttgacctcaatgaa
caagggaaactggatgtcagacgggcggtcggaactgacggaacactcagtgtcgtaaaa
gatttgggcttgcgtgattattttacgggacaagtagagattgtctcgggtgaactcggt
gatgacttcacgtattaccttgtttcttctgaacaagtcccttcatctgtcggcgtaggt
gttctagtaaatcctgataacacgattctcgctgcgggcggattcatcattcagcttctt
ccggggactgatgaagaaaccatttcaacaattgaaaagcaattatctcaaatcgaaccg
atttcaaaattgattcaaaaaggcctgacaccggaagaaatcttagaagaagttctgggt
caaaaaccggacgttctcgaaacaatgccggtcaaatttcactgttcttgttcaaaagat
cgattcgaaacggccattttaggactaggcaaaaaagaaatacaagatatgatagaagaa
gacggaaaagccgaagcggtttgccatttttgtaatgagaaatatttatttacaaaagaa
gaactggaagagcttcgtgacgaaacaacccgctag

DBGET integrated database retrieval system