KEGG   Bacillus sp. Pc3: SB24_12090Help
Entry
SB24_12090        CDS       T03544                                 

Definition
(GenBank) spore coat protein
  KO
K06330  spore coat protein H
Organism
bacp  Bacillus sp. Pc3
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    SB24_12090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CotH Blo-t-5
Motif
Other DBs
NCBI-ProteinID: AJC25854
LinkDB All DBs
Position
2518336..2519430
Genome map
AA seq 364 aa AA seqDB search
MKDQSTLPLYQLFIHPKDLMELKKDIWDDDPVPAVLRVNQKRLDIDLAYRGSHIRDFKKK
SYHIAFYSPKTFRRAKEIHLNAEYKDPSMMRNKLSLDFFAELGTLSPKANFVTLQINGRH
EGVYLELESVDEYFLAKRNLADGAVFYAVDDDANFSLVSDLERDTKTSLELGYEKKTGTK
EDDLYLQDMIYKINTVPKSEFKGEIVKHLDADKYLRWLAGIVFTSNYDGFVHNYALYRNH
ETGLFEVIPWDYDATWGRDIHGDRMEADYVRIQGFNTLTARLLDEPYFRKAYKRLLEETL
QTRFTIEHMKPKVMSLYEQIRPHVAKDPYKKEEIDCFDREPEVICEYIKERSAFISSELE
RWNI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaccaatcaacattgcctctataccagctgtttattcacccgaaagacttaatg
gagctgaaaaaagacatttgggatgatgatccggtgcccgcggtgctgagagtgaatcaa
aaacggcttgacattgatctggcgtaccgcggctcgcatataagagatttcaagaaaaaa
tcgtatcacatcgctttttattcgccgaaaacatttcgcagggcgaaagagatacattta
aacgctgaatacaaagatccgtcgatgatgcggaataagctgtctctcgatttcttcgcg
gagcttgggacgctgtcaccaaaggcgaatttcgtaaccctgcaaatcaatggcagacat
gagggggtgtatcttgagctggagtcagtggatgaatattttctggcgaaaaggaatttg
gcggacggggctgttttttacgcggttgatgacgacgccaatttctccctcgtcagtgat
ctggagcgggatacgaaaacatcgctcgaacttggttatgaaaagaaaacgggaacgaaa
gaagacgatttatacttgcaggatatgatctataaaattaataccgttccgaagtcagag
ttcaagggggagatcgtcaaacacttggacgccgataagtatttgcggtggcttgcgggc
atcgtgtttacctcaaactacgatggatttgttcataattacgctttgtaccggaatcat
gaaacgggcctttttgaagtcattccgtgggattacgatgcgacgtggggaagagacatt
cacggtgatcggatggaggccgattatgtcagaatacaagggtttaataccttgactgca
aggcttctggatgaaccgtatttccgcaaagcgtacaaacggcttttggaagagacgctt
cagacccggtttaccattgaacatatgaagccgaaggtcatgtcactgtatgagcagatc
aggccgcatgtcgcgaaggatccatataagaaagaagagattgattgctttgaccgggag
cctgaagtgatttgcgaatacattaaggagcggtcagccttcatcagcagtgagttagag
cggtggaatatctga

DBGET integrated database retrieval system