KEGG   Bacillus sp. Pc3: SB24_13705Help
Entry
SB24_13705        CDS       T03544                                 

Definition
(GenBank) ABC transporter
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
bacp  Bacillus sp. Pc3
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacp02000]
    SB24_13705
Transporters [BR:bacp02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    SB24_13705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_16 SMC_N AAA_29 AAA_30 ABC_ATPase RsgA_GTPase AAA_25 AAA_23 AAA_5 NACHT AAA_28 AAA_33 AAA_22 Mg_chelatase AAA_19 AAA SRP54 Zeta_toxin Viral_helicase1 ATPase_2 AAA_14 AAA_27 AAA_18 RNA_helicase ATP-synt_ab Rad17 DUF815 G-alpha
Motif
Other DBs
NCBI-ProteinID: AJC26163
LinkDB All DBs
Position
2880503..2881327
Genome map
AA seq 274 aa AA seqDB search
MSAISTETLSLGYGETVIIDELDVAIPKGEITVLIGSNGCGKSTLLRSLARLMKPRGGSV
LLEGKAIAKLPTKEVARELAILPQSPSAPEGLTVHQLVKQGRYPYQSWLKQWSKEDEDAV
AKALKATKLEEMADRPVDSLSGGQRQRAWIAMTLAQDTDIILLDEPTTYLDMTHQIEILD
LLFELNEKEKRTIVMVLHDLNLACRYAHYLVAIKDKQIYAEGRPEEVITCELVQQVFAMN
CQVTQDPLFGTPLCIPHGRGRCIVQEAALTARLS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaatttctacagagacgctgagcttagggtacggagagactgttatcattgac
gaattggatgtcgcgattccaaaaggcgaaatcactgtattgatcggaagcaacggctgc
ggaaaatcgacgcttttacgttcattggcccggctgatgaaaccgaggggcggttctgtg
cttttagaaggaaaagccatcgctaagcttccgacgaaggaagtggcaagagagctcgct
attttgccgcagagtccgtcagctcccgaaggcctgacggtgcatcagcttgtgaagcag
ggaagatacccttatcaaagctggctgaagcaatggtccaaagaggacgaagacgcagtg
gcaaaagcgcttaaagcgacgaagcttgaggaaatggccgaccgtccggtggattccttg
tcaggcggacagcgccagcgcgcatggattgcgatgacactcgctcaggatacggatatc
attctgcttgacgagccgacaacctatctcgacatgacgcatcaaattgaaattcttgat
ttgctgtttgaattaaatgaaaaagaaaaacgcacaatcgtcatggtgctgcacgacctc
aatctggcatgccgttatgcccattatctggtcgccattaaggataaacagatttacgca
gagggccgtcccgaagaagtcatcacttgcgagcttgtacagcaggtctttgcgatgaac
tgccaggtaacgcaagacccgctgttcggcacgccgctttgcattccgcacggacgcggc
agatgtatcgtgcaggaagcggccctcaccgcccgattgtcataa

DBGET integrated database retrieval system