KEGG   Bacillus sp. Pc3: SB24_13780Help
Entry
SB24_13780        CDS       T03544                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00071  Fatty acid degradation
bacp00280  Valine, leucine and isoleucine degradation
bacp00281  Geraniol degradation
bacp00362  Benzoate degradation
bacp00592  alpha-Linolenic acid metabolism
bacp01100  Metabolic pathways
bacp01110  Biosynthesis of secondary metabolites
bacp01120  Microbial metabolism in diverse environments
bacp01130  Biosynthesis of antibiotics
bacp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SB24_13780
   00592 alpha-Linolenic acid metabolism
    SB24_13780
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SB24_13780
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SB24_13780
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SB24_13780
   00642 Ethylbenzene degradation
    SB24_13780
Enzymes [BR:bacp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SB24_13780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJC26176
LinkDB All DBs
Position
2893762..2894937
Genome map
AA seq 391 aa AA seqDB search
MREAVIVAGARTPVGKAKKGSLAAVRPDDLGALCVKETLKRAGGYEGNIDDLIIGCATPE
AEQGLNMARNIGALAGLPHTVPAITVNRYCSSGLQSIAYGAEKIMIGAGDTVIAGGAESM
SQVPMMGHVTRPNIALAEHAPEYYMSMGHTAEQVAETYGVSREDQDAFAVRSHQNAAKAL
KEGKFNDEIVPVEVSLTEVGDDHKPRKKQFTFSQDEGVRPGTSADVLAKLRPAFSKTGTV
TAGNSSQTSDGAAAVMLMDREKASSLGLAPLVKFRSFAVGGVPPEVMGIGPIEAIPRALK
LAGLELQDIGLFELNEAFASQAIQVIRSLGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL
IHEMKRRNEQFGVVTMCIGGGMGAAGVFELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtcattgtggccggtgcgagaactccggtcggtaaagcgaaaaaagga
tcgcttgcagccgttcgtcctgatgatttaggcgcgctttgtgtaaaagaaacgctgaaa
cgggcaggcggatatgaaggaaatatcgatgacttaattatcggatgtgcaacacctgaa
gccgaacaaggattaaatatggcgcggaatatcggtgcgctggcggggcttcctcatacg
gtgccggccattacggtgaaccgctactgctcttccgggctccaatccatcgcttacggt
gctgaaaaaatcatgatcggcgcgggtgacaccgtcattgcgggcggtgcggaatccatg
tcgcaagttccgatgatggggcatgtgacccgcccgaatatcgctttggcggagcatgcg
cctgagtattacatgagcatggggcacacagcggagcaggtagccgaaacgtacggcgta
tccagagaagaccaggatgcatttgccgtccgcagccatcagaatgccgcaaaagccctt
aaagaagggaaattcaatgacgaaatcgtgccggttgaagtatcgctgacagaagtcggt
gatgaccataagccgcggaaaaaacaatttaccttttctcaagatgaaggcgttcgtccc
ggcacatcggctgacgtcttggcgaagctccgtccggctttttctaaaacgggaaccgtg
acggccgggaactcttcacaaacaagtgacggcgcggcggctgtcatgctgatggatcgc
gaaaaagcttcgtcgctcggattggcgccgcttgtcaaattccgttcctttgccgtaggc
ggcgttccgcctgaggtaatggggatcggtccgattgaagccatcccgcgggcgctcaag
cttgccggactcgaattacaggatatcgggctttttgaattgaatgaggcctttgcttca
caggccattcaagtcatcagatcgcttgggatagatgaagaaaaggtgaacgtcaacgga
ggcgccatcgcgctcggacatccgctcggatgcacgggaacgaagctgaccctgtcactc
attcatgaaatgaaacggagaaacgagcaattcggcgtggtgacgatgtgcatcggaggc
ggcatgggagctgccggcgtatttgaactcatttaa

DBGET integrated database retrieval system