KEGG   Bacillus sp. Pc3: SB24_13995Help
Entry
SB24_13995        CDS       T03544                                 

Definition
(GenBank) 5'-nucleotidase
Organism
bacp  Bacillus sp. Pc3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: AJC26216
LinkDB All DBs
Position
2933240..2934634
Genome map
AA seq 464 aa AA seqDB search
MLEKLRLYHTNDLHSHFENWPKIVHYIEQKRSEHEKNGEETLVFDIGDHMDRFQMITEAT
FGKANVDLLNRLEIDAAAVGNNEGITLPHDELADLYTHAAFPVIVSNLFDADGQRPEWAK
PYVIKTLKNGMTAGILGVTVPYYPVYQKLGWTVTDAEKSIQESLDDIKGKADIIILLSHL
GLIDDRAAAEKFPDIDVILESHTHHLLEDGQDINGVLLACAEKYGNYVGCVELTIESESR
TIVSKQASVQKMADWHGESEDTAAFLKEKEREAENLLSVQVANLNEEAGVKWFEESPLPL
LLAEALKSWCGCEVSMVNSGVILGTLQKGPVTKLDLHRICPHPINPVAVRLSGRELQETI
SQAASEQMEQLRIKGLGFRGEVMGRMVYAGAEAEAGILEDGVTHLLNVKVNGEEVDPDRI
YSVAVLDMFTLGKLFPYIRDSKEKQYFMPEFLRDLLAWKLARQP
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttagagaagctccgtttatatcatacgaatgatttgcacagccatttcgaaaattgg
ccgaaaatcgtacattatattgagcagaagagaagtgagcatgaaaaaaacggggaggaa
acactcgtattcgacatcggcgatcatatggaccgattccaaatgataacggaagcgacc
ttcggcaaagcgaatgtcgacttgttaaaccgtcttgagattgatgcggctgccgtcggg
aataatgaagggattacgctgcctcacgatgagctggcggatttatatactcatgccgcg
tttcccgtcattgtgtccaacctgtttgacgcggacggacagcgcccggaatgggccaag
ccctatgtgatcaaaacgctgaaaaacgggatgaccgccggcatactcggcgtcacggtg
ccgtattatcccgtctatcagaaactcggctggacagtgacggatgcggaaaaaagcatt
caagaatcacttgacgatatcaagggcaaagcggacatcatcattctgctttctcattta
ggcctgatcgatgaccgggccgcagcggaaaaatttcccgatatcgatgtcattcttgaa
tcacatacgcaccaccttcttgaggacggacaggacataaacggcgtattgcttgcatgt
gcggagaaatacgggaactatgtcggctgtgtcgagctcacgatagaaagtgaatcacga
accattgtcagcaaacaggcatctgtacagaaaatggctgattggcacggggaatctgaa
gatacggcggcttttctgaaagagaaagaacgggaagcggaaaacctgctctccgtacaa
gtcgccaatctgaatgaagaagccggcgtgaagtggtttgaggaatcgccgctgccgctt
ctattagccgaagcgctgaaaagctggtgcggctgtgaagtcagcatggtgaattcaggc
gtcattttggggactttacagaaggggcctgtcacaaagcttgacttgcaccgcatctgc
cctcatccgatcaatccggtcgccgttcgtctttcaggcagggaactccaggaaacaatc
agccaggccgcctcggaacaaatggagcagctgcggattaaaggcctcggcttccgcggg
gaagtgatgggcaggatggtatatgccggagcggaggcagaggccggcatccttgaagac
ggtgtgacgcatctcctcaatgtgaaagtgaacggagaagaggttgatccggatcggata
tactcggttgccgttctcgacatgtttacactcggcaagctgttcccttacatccgcgat
tcaaaagaaaaacaatactttatgccggagtttttaagagatctgctcgcctggaagctc
gcgcggcagccgtaa

DBGET integrated database retrieval system