KEGG   Bacillus sp. Pc3: SB24_16275Help
Entry
SB24_16275        CDS       T03544                                 

Definition
(GenBank) ATP-dependent DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SB24_16275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bacp03400]
    SB24_16275
Enzymes [BR:bacp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SB24_16275
DNA repair and recombination proteins [BR:bacp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SB24_16275
    RecFOR pathway proteins
     SB24_16275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 TIP49 Mg_chelatase DUF815 AAA_16 Sigma54_activat AAA_22 Rad17 TsaE AAA_3 NB-ARC NTPase_1 MCM AAA_24 RNA_helicase Resolvase AAA_14 TniB Sigma54_activ_2 AAA_18 AAA_25 AAA_17 Bac_DnaA AAA_33 T2SSE IstB_IS21 NACHT
Motif
Other DBs
NCBI-ProteinID: AJC26618
LinkDB All DBs
Position
3380492..3381496
Genome map
AA seq 334 aa AA seqDB search
MDERLVSSEADSHESIIEQSLRPQNLAQYIGQKKVKENLRVFIDAAKMRQETLDHVLLYG
PPGLGKTTLASIVANEMGVEMRTTSGPAIERPGDLAAILTALEPGDVLFIDEIHRLNRSI
EEVLYPAMEDFCLDIVIGKGPSARSVRLDLPPFTLVGATTRVGLLTAPLRDRFGVLSRLE
YYTQEELTDIVSRTADVFEVDIEKAPALEIARRSRGTPRVANRLLRRVRDFAQVLGDSRI
TEEIAHDALERLQVDALGLDHIDHKLLMGMIEKFSGGPVGLDTISATIGEEPHTIEDVYE
PYLLQIGFLQRTPRGRVVTPAVYEHFRLEAPARD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacggctcgtttcaagtgaagcagacagccatgaatcaataatcgagcaaagc
ctcaggccgcagaatctcgcccagtatatcggccaaaagaaggtgaaagaaaatctgcgc
gtgtttatcgatgcggcgaaaatgaggcaggaaacgctggaccacgttcttttatacggg
cctccgggtctcgggaaaacaacgcttgcgtctatcgtggccaatgagatgggtgtggag
atgcggacgacgtcaggtcccgccatcgaaagaccgggagatttggcagccattttgacg
gcgctcgaaccaggggatgtgctgtttatagacgaaattcacaggctgaaccgctcaatt
gaggaagtgctgtacccggcgatggaggatttctgccttgatatcgtcattggaaaaggc
ccgtccgcccgctccgtccgtctcgaccttcccccttttacgcttgtaggagcgacgaca
agggtcggattattgaccgcaccgctcagagaccggttcggggtgctgtcgcgccttgaa
tactatacgcaggaagagctgacagatatcgtgtcaagaactgctgacgtttttgaagtg
gatatcgaaaaagcaccggctctggaaatcgccagacggtcaaggggaacgccgcgggtt
gcaaaccggcttctcagaagggtgagagattttgcccaggtgctcggcgacagccgcatc
acggaagaaatcgctcacgatgcgctcgaacgtcttcaagtcgatgcgctcggccttgac
catatcgaccataagctgctgatgggcatgatcgaaaaattcagcggcggtcccgttggc
cttgatacgatttccgcgacaatcggcgaagaaccgcatacaatagaggatgtgtacgaa
ccgtatctgctgcagatcggatttcttcagaggacgccgaggggacgggtcgtgactccg
gctgtgtatgaacattttcgattggaggcgcccgcccgtgactga

DBGET integrated database retrieval system