KEGG   Bacillus sp. Pc3: SB24_16315Help
Entry
SB24_16315        CDS       T03544                                 

Definition
(GenBank) competence protein ComN
Organism
bacp  Bacillus sp. Pc3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Post_transc_reg DAP3
Motif
Other DBs
NCBI-ProteinID: AJC26626
LinkDB All DBs
Position
3387148..3387444
Genome map
AA seq 98 aa AA seqDB search
MEKHPAEMYKDHLRPFLYSKLEEFKILGYDDVEHESLWSYLIHKKWKQKKELPLHELAGH
ILSVKIGDFMNYATVEAFKSSNWLESDEGQEALDELLR
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaacatcccgccgaaatgtacaaagatcatttgcggcctttcttgtacagtaaa
cttgaagagttcaaaatcctcggatacgatgatgttgagcacgagagtttatggtcatac
ttaatacataaaaagtggaaacagaaaaaggaactgccgctgcatgaattggccggtcat
attttatcagttaaaattggcgattttatgaactatgcaaccgttgaagcttttaagtcg
tctaattggctggaaagcgatgagggtcaggaagctttagatgaactgctgagataa

DBGET integrated database retrieval system