KEGG   Bacillus sp. Pc3: SB24_16335Help
Entry
SB24_16335        CDS       T03544                                 

Definition
(GenBank) recombinase RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp03410  Base excision repair
bacp03430  Mismatch repair
bacp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SB24_16335
   03430 Mismatch repair
    SB24_16335
   03440 Homologous recombination
    SB24_16335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bacp03400]
    SB24_16335
Enzymes [BR:bacp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SB24_16335
DNA repair and recombination proteins [BR:bacp03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     SB24_16335
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SB24_16335
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SB24_16335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ssDNA-exonuc_C RecJ_OB DHHA1 DHH PGM_PMM_II
Motif
Other DBs
NCBI-ProteinID: AJC26630
LinkDB All DBs
Position
3390775..3393135
Genome map
AA seq 786 aa AA seqDB search
MLASKMRWEIQQPDQEKVKSLTEQLDITPLVASLLVKRGFDTAESARLFLHTKDADFYDP
YELKGMREAVDRIKLAVSQGEPIMIYGDYDADGVTSTSVMLTALRQLSADVDFYIPDRFT
EGYGPNEQAFRSIKERGFSLIITVDTGIAAVHEAEVAKELGLDVIITDHHEPGPELPDVF
AIIHPKQPGCGYPFKELAGVGVAFKLAHALTGSLPEAMLDLAAIGTVADLVPLHDENRLI
ASLGIERLRTTNRPGLKALIKLSGGDIGQADEETIGFQVAPRLNAVGRIEQADPAVHLLM
TEDQFEAEELASDIDRLNKERQKMVKTMTEEAVEMVQQQGGNPSAIVVAKAGWNPGVVGI
VASKLAERFYRPAVVLGIDEEQGIAKGSARSIRGFNLFTSLSQCRDILPHFGGHPMAAGM
TLKAEDVAELRDRLNQMAEETLTEEDFIPVQEVDLVCGVEDITVESITELNMLSPFGMLN
PKPHVMVKNAVLDDVRLIGANKNHVKMTVKSDSAVLDCVGFNKGELEAGIVPGSTISIVG
EMSINEWNNRKKPQLMIKDAAVPEWQLFDIRGKRTWEDTVTALPKEKRVLISFNEKTAQK
LRAKELSGELAGITSESEAEALQLDGKYAVFLDVPPSADRLQHLLDGKKPERIYFVFINH
EEHFLSSFPSRNDFKWFYAFLLKRGAFDFGKHGSELARHRGWSIDTINFMTKVFFDLGFV
KIEDGVLSVVSGAKKRDLADSQTYQVKQQLMELDQKLNYSAAHELKEWLNKLMNQGSEAY
ESTRRT
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgtcaaaaatgcgctgggaaatccagcagccggatcaggaaaaagtcaaatca
ctcacagaacaattggacataacacctcttgtggcatcactgcttgtaaaaagaggtttt
gatactgccgaaagcgcaaggctgtttttacatacaaaggatgcagacttttatgacccg
tatgaattaaagggaatgcgggaagcagttgatcggataaaactggcggtttctcaaggg
gaaccgattatgatttacggagattacgatgcagacggcgttacaagcacgtcggtgatg
ctgacggcactgagacagctgtcggcggacgttgacttttatattcccgaccgtttcaca
gaaggctacggcccgaatgaacaggctttccgctccataaaagagcggggattttcgctg
atcattacagtggatacgggaatcgccgccgtccatgaagctgaagtcgcaaaagagctg
ggcttagacgtcattattaccgaccaccatgagccgggacccgagcttcctgacgtattt
gcgatcatccacccgaagcagccgggctgcggctatccgtttaaagaattggccggcgtc
ggtgtggcgtttaagcttgcccacgcgcttacgggttctttgccggaagctatgctggac
ttggcggcaatcggtacggttgcagatctggtgcctcttcatgatgaaaacagattaatt
gcgtcactcggaatcgaaaggcttcggacgacaaatcggccgggcctcaaagccctgatt
aagctttccggcggagatatcggacaagctgatgaggaaacgatcggatttcaggtcgcg
ccgaggctcaatgccgtcggaagaatagaacaggccgatcccgccgtgcatctgctgatg
accgaagatcagtttgaagcggaggaactggcttcggatattgaccggctgaataaagag
cggcagaaaatggtgaaaaccatgaccgaagaggctgttgaaatggttcagcagcaaggc
ggaaacccgtctgccattgtagtggcaaaagccggctggaatccgggagtcgtcggtatt
gtcgcatcgaagctggctgaacgtttttaccggcccgctgttgtgcttgggatagatgag
gagcagggaatcgctaaagggtcggcgcgaagcatcagaggcttcaacctgtttacgagc
ctttcacagtgcagagacattcttcctcatttcggcgggcatccgatggcggcaggaatg
acgttgaaggctgaagatgtggcggaattaagggacaggctgaatcaaatggctgaagaa
acccttacggaagaggattttattcccgttcaggaggttgatcttgtctgcggcgtagaa
gacataaccgttgaaagcattacagaattgaatatgctgtcgccgttcggcatgcttaac
cctaaaccgcatgtgatggtgaaaaatgctgtgcttgatgatgtgcgcctgatcggagcg
aataaaaaccacgtgaaaatgacggtgaaaagtgattccgccgtccttgactgcgtcggc
tttaacaaaggagagcttgaagccggaattgtccccggatcaacgatttccattgtcggc
gagatgtccattaatgaatggaacaacagaaagaagccccagctgatgattaaagacgct
gcggtgccggaatggcagctttttgatatcaggggcaagcggacgtgggaagacacggtc
accgcgctgccgaaggaaaaacgggtgctcatcagctttaacgaaaaaaccgctcagaag
ctccgtgcaaaagagctgtcgggcgagctggccgggatcacatcggaatccgaggcggaa
gctctccagcttgacggaaaatatgccgtttttctggatgtgccgccgtcagcggatcgc
ctgcagcatttgcttgacggaaagaagccggaacggatttattttgtttttatcaatcat
gaagaacatttcctgtcctcatttccatctcggaatgatttcaagtggttttacgcattt
ctcttgaaaaggggcgcttttgacttcggcaagcatggttcagagcttgcgagacacaga
ggatggtcaattgacacaatcaatttcatgacaaaggtgttttttgatctcggttttgtt
aaaatagaagatggtgtgctgtctgtcgtgagcggcgcgaaaaaacgcgacctggcagat
tcgcaaacctatcaggtaaaacagcagctgatggaattagaccagaagctcaattattcc
gcagcccatgagctgaaggaatggctgaataagctgatgaaccaaggttcagaagcttat
gaaagtacgaggaggacatag

DBGET integrated database retrieval system