KEGG   Bacillus sp. Pc3: SB24_19130Help
Entry
SB24_19130        CDS       T03544                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bacp  Bacillus sp. Pc3
Pathway
bacp00020  Citrate cycle (TCA cycle)
bacp00310  Lysine degradation
bacp00380  Tryptophan metabolism
bacp01100  Metabolic pathways
bacp01110  Biosynthesis of secondary metabolites
bacp01120  Microbial metabolism in diverse environments
bacp01130  Biosynthesis of antibiotics
bacp01200  Carbon metabolism
Module
bacp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bacp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SB24_19130
  09105 Amino acid metabolism
   00310 Lysine degradation
    SB24_19130
   00380 Tryptophan metabolism
    SB24_19130
Enzymes [BR:bacp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SB24_19130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJC27163
LinkDB All DBs
Position
3953934..3956768
Genome map
AA seq 944 aa AA seqDB search
MFQNNMKQRMNWEDFYGPNLGYALELYDQYAEDPDSIDPDLKDMFDELGAPPSQIKEASG
TKEQGRVTADLIQKIAAAVKLAEDIRTYGHLNASVNPLRKDPKKSELFPLSEYGLTEEEM
KAIPASVICKDAPANITNGLEAIQHLRNTYKRTISFEFDHVHDFEERAWITKMVESGELF
RKNSPEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGISYGWTGDVKYHLG
ADRQLQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQKGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESDESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKRIFAEKLVSEGLISEEKAQNIETTVTKRIEDAYKKVPAKKEDAVREIELPE
PVSNGFPDVDTAIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGEEFVALHHLDDCAASFTVHN
SPLSEGSVLGFEYGYNVYSPETLVMWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFKPVYEQSGLSHAYEKVTRVVLSSGKVSIDISDHF
NKMEGDKDWLHIARIEQLYPFPAKDTKELFAKLPNLQEIVWVQEEPQNMGAWSYISPYLT
EIAPKGVNVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaataatatgaaacaaagaatgaattgggaagatttttacggaccgaacctc
ggctacgcactggagctgtacgaccaatatgctgaagatccagacagcattgatccggat
ctgaaagacatgtttgacgaactaggcgctccgccaagccaaataaaagaggcatcggga
acaaaggaacagggacgcgtcaccgcagatctgattcaaaagatcgcagcagcagttaaa
cttgcagaagatattcgaacctatggccatctgaacgcttccgtcaatccgctcagaaag
gatccgaaaaagagcgagctctttccgttatccgagtacgggcttacagaagaagaaatg
aaagcaatacccgcgtctgtcatctgtaaagacgcacctgccaatataacaaacggctta
gaagccatccagcatttacgcaatacctataaaagaaccatctccttcgagtttgaccat
gtgcatgatttcgaagagcgcgcatggattacaaaaatggtcgaatccggagaactgttc
cggaaaaattcaccggaaaaactgtcagccgttttagaaagactgacggaagtagaagga
tttgaacaatttttacaccggacattcgtcggtcagaagcgtttctcaattgaggggtta
gacgcgcttgtgccggttcttgacgacattatcgcccagtctgtgaaagcgggcacaacc
aatgtcaatatcgggatggcgcacagaggccgtttaaatgtgcttgcgcatgtgctcggc
aaaccgtatgagattattttctcagaattccagcacgcgccgaataaagatcttgtgccg
tctgaaggatcgaccggcatcagctacggctggacgggcgatgtaaaataccacctcggt
gcagacagacagcttcaggatgctgaaaccaaaagcgcgcggattacgcttgcaaacaac
ccgagccatttggaattcatcaatccgattgttgaaggaagcacgcgggcggcacaggaa
acaagaacgcaaaaggggtacccggttcaagacgaaacaaaatcgctcgccattttaatt
cacggtgacgcagcgtttccgggagaaggcattgtcgccgagacgctgaacttaagctct
ctgaaaggctatcaggtcggcggggccattcatatcatcgccaataatatgatcggcttt
acaactgaaagcgatgaatcacgatccacgaaatatgccagtgatttggcgaagggctat
gaaattccgatcgttcacgtcaacgcggatgatccggaagcatgcctgtcagccgttaaa
tttgcggttgaataccggaagcggttcaataaagatttcttaatcgatttaatcgggtac
agacggtacggccacaatgaaatggatgagccgtcaacgacacagccgatgctgtatgac
gccgtcagaaaacacccgactgtcaagcggatctttgcggaaaaactcgtaagtgaagga
ctgatcagcgaggaaaaagcgcaaaacatcgaaacgacagtgacaaaacgaattgaagac
gcctataaaaaggtgcccgccaaaaaagaagacgccgtacgggaaattgaattgccggaa
ccggtgtccaacggttttcccgatgttgacacagccattgattttgatgttctccgcaag
ctgaacggcgaacttatcaactggccggaatcttttaacgtgttcggcaagctgaaaaga
atcctggaaagacgtgcaaaagcgtttgatgatgaccgtaaagttgaatggtcattggct
gaatcgcttgcgtttgcttccattttgaaagacggcacgccgatccggctgaccggacag
gattcagagcgcggaacgttcgctcaaagaaaccttgtgctgcatgacagcgaaacagga
gaagaatttgttgccctccatcacttagacgactgcgctgcttcatttacggtgcataac
agcccgctctctgaaggatcggttctcggctttgaatatggatacaacgtgtattcgcct
gaaacgcttgtgatgtgggaggcgcagtacggggactttgccaatgcggctcaagtctat
tttgatcaattcatatctgcaggacgggcaaaatggggacaaaaatcaggactggtcatg
ctgctgcctcacggttacgaagggcagggccctgaacactccagcggccgcgtcgagcgg
ttcctgcagctggcggcggaaaacaactggacggtggccaacctgacaagtgcggctcag
tatttccatattttaagaagacaagcgaaaatgctgcttcgtgaggaaatccgcccgctt
gtgatcatgacgccgaagagcctgctgcgcaacccgaatacggtatctgaagtgcaggaa
ctgagcgaaagccgattcaagcctgtctatgagcagtccggtctttcccatgcttacgaa
aaagtgactcgcgtcgtattatcaagcggaaaagtgtcaattgatatcagcgatcacttc
aacaaaatggaaggcgataaggattggcttcatattgccagaatcgaacagctgtatccg
ttcccggcaaaagatacgaaggagcttttcgccaaactgccgaacctgcaagagatcgtt
tgggttcaggaagagccgcagaacatgggggcatggagttatatcagcccgtatctgacg
gaaatcgcgccaaaaggagtaaatgtccaatacatcggccgaagaagacgatccagtccc
gcagaaggagatccgacagtccacaaaaaagaacaggaacgcattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system