KEGG   Bacillus sp. Y1: DOE78_01970Help
Entry
DOE78_01970       CDS       T05922                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bacq  Bacillus sp. Y1
Pathway
bacq00970  Aminoacyl-tRNA biosynthesis
bacq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DOE78_01970
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bacq03029]
    DOE78_01970
Enzymes [BR:bacq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DOE78_01970
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DOE78_01970
Mitochondrial biogenesis [BR:bacq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DOE78_01970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AYA74318
UniProt: A0A385NM44
LinkDB All DBs
Position
378896..380323
Genome map
AA seq 475 aa AA seqDB search
MEFETVIGLEVHVELKTESKIFSASPNHFGAQPNTNTTVIDLGYPGVLPVLNKKVVDYGM
KACMALNCNVATHTKFDRKNYFYPDNPKAYQISQFDQPIGEHGFIEIEVDGYKKKIGITR
IHLEEDAGKLNHENGYSLCDYNRQGTPLIEIVSEPDIRTANEAYAYLEKLKSIIQYTGVS
DCKMEEGSLRCDANISIRPVGQEEFGTKTELKNLNSFNFVRKGIEYEAKRQEEVVRAGGE
IQQETRRYDEATNTTLLMRVKEGSEDYRYFPEPDLTDLYIDEEWKARIAAEIPELPDSRQ
KRYTEEWGLPAYDAAVLTVVKETADFFEATVAAGADPKQASNWIMGELSAYLNSEQKELA
DVALTPEGLAGMIKLITDGTISSKIAKKVFKELVEKGGSAEKIVKDQGLVQISDEGALLT
VIAEVLDANPQSIDDFKNGKEKAIGFLVGQIMKATKGQANPPLVNKLLQQEIRKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgaaacggtaattggacttgaagtccatgtagagttaaaaacagaatcaaaa
atcttctctgcaagtcccaaccattttggtgcgcagccaaataccaatacaacggtgatc
gaccttggatatccaggtgtgttgccggtattaaataaaaaggtagttgactacgggatg
aaggcttgtatggccttaaactgtaacgtcgcaacccatacgaagtttgatagaaaaaac
tacttttatccagataacccgaaagcgtaccagatttctcaatttgaccagccgattggt
gaacacgggtttatcgaaattgaagtagacgggtataagaagaaaatcggcatcacaaga
attcatttagaagaggatgctgggaagctgaatcatgaaaatggatactctctatgtgac
tacaatcgtcagggaacacctcttattgagattgtatcagagccggatattcgtacagcg
aatgaagcatatgcttatttagaaaaattaaaatcgattattcaatatacaggagtatct
gattgtaagatggaggaaggctccttacgttgtgatgcgaatatttcgattcgtccagta
ggacaagaggaatttgggacaaagaccgagttaaagaacttaaattcatttaactttgtt
cgtaaaggaatcgaatatgaagcgaagcgtcaggaagaagtggttcgagctggaggagag
attcagcaggaaacacgtcgttatgacgaggcaacgaatacgactttattaatgagggta
aaagaaggttcggaagattatcgttacttccctgaaccagatttaacggatttgtatatt
gatgaggaatggaaggcccgcattgctgcagaaattcctgagcttccagattcaagacag
aagcgttataccgaagagtggggattaccagcgtatgatgcggctgttttaacagttgta
aaggaaacagctgacttttttgaagcaacggttgctgctggagcggatccaaaacaagca
tccaactggattatgggagaattatcagcttatttaaattccgaacaaaaggaacttgct
gatgtagccctaacaccagaaggtcttgcaggaatgattaagctcattactgacggaacc
atttcttctaagattgcgaagaaggtatttaaagagcttgttgaaaaaggcggcagtgcg
gagaaaattgtaaaagaccaaggtctggtacaaatttctgatgaaggtgctctactaaca
gtaattgctgaagttcttgatgccaatccacaatccattgacgattttaaaaatggtaag
gaaaaggcgattggtttccttgttggtcagatcatgaaagcaacaaagggccaagcaaac
ccaccactagtaaacaaactattgcaacaagaaatcagaaaacgctaa

DBGET integrated database retrieval system