KEGG   Bacillus sp. Y1: DOE78_09080Help
Entry
DOE78_09080       CDS       T05922                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bacq  Bacillus sp. Y1
Pathway
bacq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DOE78_09080
Enzymes [BR:bacq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DOE78_09080
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DOE78_09080
    1.1.1.-  
     DOE78_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C F420_oxidored ADH_zinc_N_2 DapB_N
Motif
Other DBs
NCBI-ProteinID: AYA75586
UniProt: A0A385NN58
LinkDB All DBs
Position
1848436..1849494
Genome map
AA seq 352 aa AA seqDB search
MRAALWYNRKDIRVESIPEPVVEKDQVKIKVEYCGICGSDLHEYLAGPIFIPVEEPHPLS
EDQAPIVMGHEYAGEVVEVGNEVSRFKIGDRVCIEPIYNCGTCASCLKGHYNVCEQLGFI
GLSGGLGGFSEYSVVPDKMVHKIPDHMSWEQAALVEPTAVAVHAVRQSEMRIGDSVAVIG
TGPIGLLVIQAAKAAGASQIIAVEVSPERREIALQVGAHMAINPMEVDAVDEIKSYTNGL
GVDVAFEVAGIDATINTAIQATKAEGNVVNISIWEKPATIPVNNFILTERKMTSIIAYRN
IFPQVIQLIANRQIQAERLITKKISLNQIVDEGFDALTRSKNQIKILVDPSQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgctctctggtataacagaaaagatatacgtgtggaaagtattcctgaacct
gttgttgaaaaagatcaggtgaaaataaaagtagagtattgtggaatttgtgggtcggat
ttacacgaatatctagctgggccaatttttatacccgttgaagagccgcaccccctatca
gaggatcaagcaccgattgtgatgggacatgagtatgctggtgaagtagttgaagtaggt
aatgaagtaagcagattcaagataggggaccgtgtatgtattgaaccgatttataactgt
ggaacgtgcgcttcatgtctaaagggacattataacgtatgtgaacagctcgggttcata
ggtctttctggtgggcttggaggtttttcggaatatagtgtcgtcccagataaaatggtt
cataaaattcctgaccatatgtcatgggaacaggctgcacttgtcgagccgacagctgta
gctgtacatgcggttcgacaaagtgaaatgagaataggggactctgtcgcagttatcggt
acaggaccaatcggtttattagttattcaagcagcgaaagcagcaggagcaagtcagatt
attgcggttgaggtttctcctgaacgtcgtgaaatagcgttacaagtaggggctcatatg
gccatcaatccaatggaagtggatgcagtggatgaaataaaaagctataccaatggctta
ggggtggatgttgcctttgaggtggctggaattgatgcaacaattaacacagctatccaa
gcgacgaaagccgaagggaatgtagtaaacattagcatttgggaaaaaccagctactatt
ccggtgaataactttattttaactgagagaaagatgacaagtattattgcatatcgtaat
attttccctcaagttattcaattgattgcgaataggcaaattcaagctgaaagactaatt
acgaaaaaaatctcccttaatcaaatagtcgatgaaggatttgatgcattaacaaggagt
aagaaccagattaagattttagtagacccttcacaataa

DBGET integrated database retrieval system