KEGG   Bacillus sp. Y1: DOE78_15180Help
Entry
DOE78_15180       CDS       T05922                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bacq  Bacillus sp. Y1
Pathway
bacq00564  Glycerophospholipid metabolism
bacq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DOE78_15180
Enzymes [BR:bacq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DOE78_15180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 GDI
Motif
Other DBs
NCBI-ProteinID: AYA76677
UniProt: A0A385NQG6
LinkDB All DBs
Position
complement(3106380..3108059)
Genome map
AA seq 559 aa AA seqDB search
MIFSNKNRKHLVSELSTKHYDVLVIGGGITGAGISLDASLRGMKTAVVDMQDFSAGTSSR
STKLVHGGLRYLKQFQVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHQGGTFGKFSTSL
GLRVYDFLAGVKKSERRMMFSANETLTKEPLVRQDGLKGGGYYVEYRTDDARLTIEVMKA
AVDKGACAINYTKVEKLVYEHGKIVGAKVSDLISGESYEIRAKKVINAAGPWVDSIRELD
RSKSGKVLKLSKGVHIVIDQERFPLKQAIYFDTPDGRMVFAIPRDGKTYVGTTDTFYNDS
IAQPRMTTSDRDYIIASINYMFPTVHISVDDIESNWAGVRPLIWEEGKNPSEISRKDEIW
ESKSGLITIAGGKLTGYRKMAETVVDLLSKKYSEELGEKFSSCRTKDYPISGGDVGGSRG
FNMYISNQVKKGVEGGLSTEDATKLTKMYGSNVPKLLEVIKNNKEQAKKYQMPVTLFAQL
KYAVDHEMAYSPIDFFNRRTGALLFDIETVKTYKDQVIDFMAEELEWNKEIKQKYQKELE
IEVLYATVPIDDQTNEKLA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgatcttttcaaataaaaatcgaaaacatttagtaagtgaactttcaacaaagcattat
gatgtattagtcattggtgggggaattacaggtgctggaatttcgctagatgcctccctt
cgaggaatgaaaacggcggttgttgatatgcaagacttttctgctggaacttccagcaga
tcaacaaaactagttcatggtggattgcgttatttaaagcaatttcaggtaaaaatggtc
gctgaggttggtaaggagagggccatagtttatgagaatggtccacatgtaactaccccg
gaatggatgctgcttccttttcaccaaggaggaacgtttggaaagtttagtacctcttta
gggttgcgtgtgtatgattttttagcaggagtaaaaaagtcggagagaagaatgatgttc
tctgcgaatgaaactcttactaaggaaccacttgtgaggcaggatgggttaaagggtggc
ggttattatgtcgaatatcgtacggatgatgcaaggcttacaatagaagtaatgaaggca
gcggttgacaagggtgcatgtgcgattaattatacaaaggtagaaaaactcgtttatgaa
catggtaaaattgttggcgcgaaagtaagtgatttaattagtggagaatcatatgaaatt
cgggcaaagaaagtgataaatgctgctggtccttgggtggatagtattcgagaacttgat
cgatccaaatctgggaaggtgctaaagctttccaaaggtgtgcatattgttattgatcaa
gaaagatttcctctcaaacaagccatttactttgatacaccggacggtagaatggttttc
gccatccctagggatggaaaaacttatgtaggtacgacagataccttctataacgactcc
attgcccagcctagaatgacaacaagcgatcgagattatattatcgctagtatcaactat
atgtttccaacggttcatatttctgttgatgatattgaatcgaattgggccggagtgaga
ccattaatatgggaggaagggaaaaatccttctgaaatttcaagaaaagacgaaatatgg
gaatcaaaatcaggtttgattacgatcgcaggtggcaagttaacaggctatagaaaaatg
gcggaaacagtggttgacttattatccaaaaaatacagtgaagaattaggagagaaattt
tctagttgtcgcaccaaggattatcctatttctggaggcgatgttggaggtagtagagga
tttaatatgtatatttctaatcaagtcaaaaagggagttgaaggaggactatcaaccgaa
gacgcaacgaaattgactaaaatgtatggctccaacgtgcctaaactacttgaggttatt
aaaaataataaagaacaagcaaagaaatatcaaatgcctgtaacattatttgcacaatta
aaatacgcagtcgatcatgaaatggcgtattcaccgattgacttcttcaaccggagaaca
ggggctcttctttttgacatagagactgtaaaaacatataaagatcaagtgattgatttc
atggctgaagaacttgagtggaataaagaaatcaaacagaagtatcagaaggaattggaa
attgaagtgttatatgcaacagttcccattgatgatcaaactaatgaaaaattagcatag

DBGET integrated database retrieval system