KEGG   Bacillus sp. Y1: DOE78_22165Help
Entry
DOE78_22165       CDS       T05922                                 

Definition
(GenBank) imidazole glycerol phosphate synthase subunit HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
bacq  Bacillus sp. Y1
Pathway
bacq00340  Histidine metabolism
bacq01100  Metabolic pathways
bacq01110  Biosynthesis of secondary metabolites
bacq01230  Biosynthesis of amino acids
Module
bacq_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DOE78_22165
Enzymes [BR:bacq01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     DOE78_22165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth NMO Dus TMP-TENI G3P_antiterm ThiG IMPDH PcrB DHO_dh
Motif
Other DBs
NCBI-ProteinID: AYA77886
UniProt: A0A385NUM7
LinkDB All DBs
Position
complement(4466633..4467391)
Genome map
AA seq 252 aa AA seqDB search
MLTKRIIPCLDVKDGRVVKGIQFVQLRDAGDPVELARFYDEQGADELVFLDISASHEGRG
TMVDVVKSVASELAIPFTVGGGINSLEDMKRILRAGADKVSLNTAAVLNPELITEGANFF
GTQCIVVAIDAKYDEELGSWRVFTHGGRKTTEYEVIQWAKEAVRRGAGEILLTSMDSDGE
KKGFDVALTRAVSEAVSVPVIASGGAGNSEHFAEAFLEAKADAALAASIFHYKETSVEEV
KSFLKEKGVNVR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgctaacaaagcgtattattccttgcctggatgtgaaggacggtcgtgtggtaaaagga
attcagtttgtacagctgcgcgatgctggagaccctgtggaactggctcgtttttacgat
gagcaaggagcagatgagttagtctttttagatatctctgcttcacatgaaggtcgcgga
acgatggtggatgtggtgaaatctgttgcatccgagctagcgattccgtttactgtaggt
ggaggaatcaattccctagaagatatgaagcgcattttacgtgcgggtgcggataaagtg
tcattgaatacagcagctgtgcttaaccctgagctcattacagaaggagcgaacttcttc
gggacacaatgtattgtcgttgctattgatgcaaaatacgacgaagagcttggttcgtgg
cgtgttttcacgcatggtggtcgaaaaactaccgaatatgaagttatacaatgggcaaaa
gaggcggttcgccgcggggcaggagaaattctgttaacaagcatggatagtgatggagag
aaaaaaggctttgatgtggcactaactcgtgctgtgagcgaggcggtatcggtgccggtc
attgcttctggtggagcaggaaactctgagcattttgcggaagcctttttagaagcaaag
gcagatgcagcattagcggcatcaattttccactataaggaaacatcagttgaagaagtg
aaatcatttttaaaagaaaaaggggtgaatgtacgatga

DBGET integrated database retrieval system