KEGG   Bacillus sp. Y1: DOE78_22920Help
Entry
DOE78_22920       CDS       T05922                                 

Definition
(GenBank) flagellar hook-associated protein FlgK
  KO
K02396  flagellar hook-associated protein 1 FlgK
Organism
bacq  Bacillus sp. Y1
Pathway
bacq02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    DOE78_22920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bacq02035]
    DOE78_22920
Bacterial motility proteins [BR:bacq02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    DOE78_22920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod Baculo_PEP_C CSN4_RPN5_eIF3a FlgT_N
Motif
Other DBs
NCBI-ProteinID: AYA78021
UniProt: A0A385NU69
LinkDB All DBs
Position
complement(4643241..4644791)
Genome map
AA seq 516 aa AA seqDB search
MRSTFMGLETARRGMFTQQSALNTTGHNIANASTPGYTRQRVNFTQTQPYPNVGLNKPQL
PGQMGTGVEAGSVQRVRESFLDVQYRGENNKLGYWEARAESYTKMEEIMNEPSDSGLSQT
MDMFWQSLQDLAVNPSNPGARSVVRQRAVAVTETFNYLASSLNGIRADLKNEITVTEKEI
NSLSEQINNINNQIASVEPHGLLPNDLYDERDRLIDQLSSLVNIKVEYTSSGGNASTLAE
GKANITLLDANGASLGQLVNGTGFNKLTVNFNGTDESVKTVQLGATQLDFQQFSSTGKLR
AIVESYGYENSTGDVTGVYPDMLAELDNMAYMFAYQFNLQHQDGATPNQINGTTTDDTPA
FFSDTENGEVNIANKKGMASRLQVSDQIMASLDNIATSSKENPTMGDSTNISALAEIINK
PFKYGNNTESSFRNYYEVLVGGMAVDSQEAARLSANSGTLRQAVEERRMSVSSVSLDEEM
TNMIQFQHAYNASARMITLQDEMLDKIINGMGTAGR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaacatttatgggattagaaacagcccgtagaggtatgtttacacaacaaagt
gctttaaacacgacaggtcataatatcgcaaatgcaagcacaccaggatatacaagacaa
cgtgttaacttcacacaaacacagccttatccgaatgtgggcctaaataagcctcagctt
ccaggtcaaatgggaacgggtgtagaggctggttcggttcaacgagtgagagaaagcttc
ttagatgttcagtatcgtggagagaataataaattaggatactgggaagcacgtgcagaa
tcgtacacaaagatggaagagattatgaacgagccatcggatagtggattatctcaaacc
atggatatgttctggcaatcattacaggacttagctgtcaatccgagcaaccctggtgca
cgttcagtagtaagacaacgtgcagttgccgtaacagagacatttaactatctagcaagt
tctttaaacggaattcgtgctgacttgaaaaatgaaatcacagttacagaaaaagagatt
aattctttatcagagcaaattaataatataaataaccagattgctagtgttgagccgcat
ggcttgttaccaaacgatttatacgatgagcgtgatcgacttattgatcagctatcctca
ctcgtaaatatcaaagtggaatacacttcaagtggtgggaacgcttctactcttgcagaa
ggaaaagcgaatatcactttacttgatgcaaatggtgctagcctaggtcagctagtgaat
gggacaggctttaacaagttaactgttaactttaacggaacggatgaatctgtaaagact
gtacaattaggagcaacccagttagattttcaacaattcagttcaactggaaagcttaga
gcaatagttgaatcttatggctatgaaaactctacaggtgatgtaacaggagtttaccca
gatatgctagctgaattggacaatatggcttacatgtttgcttatcagttcaatcttcag
catcaggatggcgcaacaccgaatcaaattaacggaacaactactgatgataccccagca
tttttttcagacacagaaaatggagaggttaatattgctaataaaaaaggcatggcttct
cgtttgcaagtatcagatcagatcatggcaagtttagacaatattgcaacatctagtaag
gaaaacccaaccatgggtgactcaacaaatatttctgcgttagctgagattatcaataaa
ccttttaaatacggaaacaacacagaatcaagcttccgaaactattatgaagtcctagtt
ggtggaatggcagttgattcacaggaagcagcaagactttctgcaaacagtggtaccctt
cgtcaagctgttgaagaaagaagaatgtctgtaagctctgtttcactggacgaggaaatg
acaaatatgattcaattccaacatgcttacaatgcttctgctagaatgattacattacaa
gatgaaatgttagataaaattattaatggtatgggaaccgctggaaggtag

DBGET integrated database retrieval system