KEGG   Bacillus sp. SDLI1: AUL54_02740Help
Entry
AUL54_02740       CDS       T05207                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacs  Bacillus sp. SDLI1
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacs01001]
    AUL54_02740
Enzymes [BR:bacs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AUL54_02740
Protein kinases [BR:bacs01001]
 Serine/threonine kinases: Other
  Bacterial family
   AUL54_02740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Kdo APH RIO1 Haspin_kinase Pkinase_fungal Seadorna_VP7 PBP_N DUF4366 Trp_oprn_chp DUF2956 SNARE
Motif
Other DBs
NCBI-ProteinID: AME05332
UniProt: A0A109WEC7
LinkDB All DBs
Position
complement(625382..627325)
Genome map
AA seq 647 aa AA seqDB search
MLTGKRISGRYHILRPIGGGGMANVFLAEDIILEREVAIKILRFDFVNDIEFIRRFRREA
QSASSLDHPNIVSIYDIGEEGDIYYIVMEYVEGMTLKEYITAHGPLHPKEALSVMEQIVS
AIAHAHQNHIVHRDIKPHNILIDHSGHIKVTDFGIATALTSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGKIPFDGESAVSIALKHLQTETPSARKWNPSIPQS
VENIILKATAKDPFHRYDSAEDMEADIRTAFDAGRLNEQKFSVQDDEEMTKAIPVITDGA
KAAPHAETPEETDDKEQQPAKKKKRKWPWILLAVCFIFIMAAVLAVTVFPSLFMPKDVSV
PDVRGMKYEKAEALLEKNGLEADPDMADIEDEKIEEGLMVKTDPKAGSAVKEGSSVKLYK
SIGKPKTQLIDVKSRQIDDAKKALKDKGFKHVNIKEENDDSAAGTVIDQSPSAGTDMVAS
DDEVSLTVSLGPADVTLRDLKTYSKEAASGYLEDNGLQLVEKEAHSDDVPVGQVMKQEPS
AGTAVKPGSNVEVTFSLGPEEKPAKTVKEKISIPYEPEHEGDELEVQIAIDDKDHSISDT
YDSFKIKEPTEKTIELKIDQGQKGYYQVMVDHKVVSYKTIEYPEDKD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccggcaagcggatcagcgggcgttatcatatcctccggcccattggcggcggc
ggaatggcgaacgtttttttagctgaggacatcattctcgaacgtgaagtcgcaattaaa
attctgcggtttgactttgtgaatgacattgagtttatcaggcgtttcagaagagaagca
cagtcggcatcaagccttgaccatccgaatatcgtcagtatttacgatatcggggaggaa
ggcgatatttattacattgtcatggaatatgtggaaggcatgacattaaaggaatacata
accgcacacggaccgcttcatccgaaagaagcgctgtccgttatggagcagatcgtctca
gccatcgcccatgcccatcaaaatcatattgtgcaccgggatattaaaccgcacaatatt
ttgatagatcattcagggcatattaaggtgacggatttcggcatcgccacagccctcacc
tcgacgacaatcacacatacgaattctgtgctgggctcggttcattatttgtctccggag
caggcgagaggcggtctggcaacgaaaaaatcagatatttacgcactcggcatcgtgctg
tttgagcttttaacaggcaaaatcccttttgacggagaatcagccgtaagcatagcatta
aagcacttgcagacagaaacgccttccgccagaaagtggaacccttcgattccgcagagc
gttgaaaacattattttaaaggcaaccgccaaagatccgtttcaccgctatgacagcgca
gaggacatggaagcggacatcagaacggcttttgacgccggcaggctgaatgaacaaaaa
ttttccgtgcaggatgatgaggaaatgacgaaagcgattcccgttattactgacggcgca
aaagccgcgcctcatgcggaaacgccggaggagacggacgataaagaacagcagcccgcc
aaaaagaaaaaacggaaatggccgtggattctgctggccgtctgcttcattttcattatg
gcggctgttcttgcagtcaccgtgttcccgtctctgtttatgcccaaagatgtaagcgtc
cccgacgtacggggcatgaagtacgaaaaagcggaagccctgctggaaaagaacggtctc
gaagccgaccctgatatggcggacattgaagatgaaaaaatcgaagagggattaatggtc
aaaactgatccgaaagcgggatctgccgttaaagaaggctcttctgtaaaactgtacaaa
agtatcgggaaaccgaaaacgcagctgatcgacgtgaaaagccggcagatcgacgacgcg
aaaaaagcgctgaaggataaaggcttcaaacatgtcaatataaaagaagagaatgatgac
agtgcggcaggcaccgtgattgaccagagcccgtcagccggcaccgacatggtcgcaagc
gatgatgaagtcagcttaacggtcagcctcgggccggcggatgttacgctgagggactta
aaaacttacagcaaagaagcggcttcggggtatcttgaagataatggcctgcagcttgtt
gaaaaagaagcgcattcagatgacgtgccggtaggacaagtcatgaagcaagagccgtca
gccggcacagcggttaagccgggaagtaatgttgaagtgacgttttcgctcggacctgaa
gaaaaaccggcgaaaacggtaaaagaaaaaatcagcattccctacgaacccgaacatgaa
ggggacgagcttgaagtgcaaatcgccatcgacgataaagaccacagcatctctgatacg
tatgattcgtttaaaattaaagagccgactgaaaaaacgattgaactgaagattgatcaa
ggacaaaaagggtattatcaagtgatggtcgaccataaagtcgtcagctataagacgatt
gaataccctgaagataaagactga

DBGET integrated database retrieval system