KEGG   Bacillus sp. SDLI1: AUL54_04210Help
Entry
AUL54_04210       CDS       T05207                                 

Definition
(GenBank) holin
Organism
bacs  Bacillus sp. SDLI1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1
Motif
Other DBs
NCBI-ProteinID: AME05608
UniProt: A0A0X8KEH7
LinkDB All DBs
Position
complement(969774..970037)
Genome map
AA seq 87 aa AA seqDB search
MKFADKGTVVRTVLLLLALLNQTLLMFGKSPLDIQEDQVSQLADTLYAAGSAVFTIVTTA
AAWFKNNYVTAKGKKQQALLKINNLSK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgcggacaaaggcacggtcgtcaggacggtgcttcttttgcttgctttatta
aaccagactttgctgatgttcggcaaatcgccgcttgatattcaggaggaccaggtcagc
cagcttgcagatacactgtatgccgccgggtcggccgtttttacgatcgtaacgacagcc
gcagcctggtttaaaaacaattacgtcacagcaaaagggaaaaaacagcaggctttatta
aaaataaacaatttatcgaaatag

DBGET integrated database retrieval system