KEGG   Bacillus sp. SDLI1: AUL54_05830Help
Entry
AUL54_05830       CDS       T05207                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00564  Glycerophospholipid metabolism
bacs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AUL54_05830
Enzymes [BR:bacs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AUL54_05830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: AME05908
UniProt: A0A0X8KF36
LinkDB All DBs
Position
complement(1279023..1280690)
Genome map
AA seq 555 aa AA seqDB search
MMNHQFSSLERDHMLEDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGT
SSRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFS
TSIGLRVYDYLAGVKKSERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEV
MKEAVKFGAEPVNYSKVKELLYEKGKVVGVLIEDLLSGKEYKVYAKKIVNATGPWVDELR
EKDHSKSGKHLQHTKGVHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVY
KQKLEHPRMTVQDRDYVVSSINYMFPELNITADDIESSWAGLRPLIHEEGKDPSEISRKD
EIWTSQSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGGQDFGGCKTKSWPISGGHVGG
SKNFESFVEAKTKDGLKIGLSQETAKQLAIRYGSNVENVFSRIEGLKDEAAKRQIPVHIL
AEAAYSIEEEMAATPADFFVRRTGRLFFDIKWVQTYKTAVIDYMSDRFQWDDETKAKHTE
WLNTLLHDAVVPLEQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaccaattttcgagtttggaacgggatcatatgctggaagacatgactaaa
aaaacatacgatctgtttattataggcggaggcattacgggtgccggtacggcgcttgac
gctgcttcaaggggaatgaaagtcgctttgagcgaaatgcaggatttcgcggccggcaca
tcaagccgatccacaaagcttgtccacggcggtttgcgttatctgaagcaattcgaagtc
aaaatggtggctgaagtcggtaaagaacgtgccattgtatacgaaaacggcccgcacgtc
acgacgccggaatggatgctgcttccgttccataaaggaggcacattcggttcattctct
acgtccatcggtctgcgtgtatatgactatttagcaggggtaaaaaaatcagagcgcaga
agcatgctgtctgcaaaagaaacgctgcaaaaagaaccgctcgtcaaaaaagacggctta
aaaggcggaggctactatgtagagtaccggacggacgacgccagactgacgattgaagtc
atgaaagaagccgttaaattcggtgcggagcctgtcaactattctaaagtgaaagagctg
ctttatgaaaaaggaaaagtcgtcggcgttttaattgaagatctgctgtcaggcaaggaa
tacaaagtttacgcaaaaaaaatcgtcaatgcgacaggtccttgggtcgacgagctgaga
gaaaaagaccacagcaaaagcggaaagcatctccagcatacaaaaggggtccatctcgta
ttcgaccaatccgtattcccgcttaaacaggctgtatattttgacacgccggacggacgg
atggtgttcgccattccgcgtgaaggaaaaacatacgtgggcacgacagacacggtttat
aaacaaaagcttgagcatccgcgcatgacggtgcaggatcgtgattatgtcgtcagctcc
atcaattatatgttcccggaactgaatattacggcggacgatattgaatcaagctgggcc
ggcctcagaccgctcattcacgaagaaggaaaagatccgtccgagatctcccgtaaagat
gaaatctggacatctcaatctggcttgatcacaatcgccggaggaaaactgacgggctac
cgtaaaatggctgagcacattgtcgatcttgtccgcgaccgcttaaaagaagagggcggc
caggacttcggcggctgtaagacgaagtcctggccgatttccggcggacatgtcggcggc
tctaaaaacttcgagtcatttgtggaagcaaagacaaaagacggattgaaaatcggttta
tcacaggaaacagctaaacagttagccatcagatacggctctaacgtcgaaaatgtattc
agccggattgaaggcctgaaagatgaagcggcaaaacgccagattccggttcacattctg
gcggaagcggcttacagcattgaagaagagatggctgcgacacctgctgatttcttcgtc
cgcagaacgggcagactgttcttcgacatcaaatgggtgcaaacgtataaaacggctgtg
attgattacatgagcgaccggttccaatgggatgacgaaacgaaagcgaaacataccgag
tggttaaacacgctgctgcacgatgcggttgttccgctcgaacaataa

DBGET integrated database retrieval system