KEGG   Bacillus sp. SDLI1: AUL54_07420Help
Entry
AUL54_07420       CDS       T05207                                 

Definition
(GenBank) hypothetical protein
Organism
bacs  Bacillus sp. SDLI1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglut_core DUF4129 Transglut_core3
Motif
Other DBs
NCBI-ProteinID: AME06188
UniProt: A0A0X8KFL6
LinkDB All DBs
Position
complement(1590537..1592744)
Genome map
AA seq 735 aa AA seqDB search
MPHDENQGSRLSLLLFYFLAFLLLWEWLRPLHNFTDTKHTGFFIVFIGLAFLLSFFRMRW
YVTVPSCILFTLISIHMLFYKGSVFQPEWLASFLRDVMLNVRHIGTGRWNDMNPSFRTLL
FFVLLWLLVYLLHYWVIYQRKILFFFIMTVAYITVLDTFTPYDAAYAVIRIVFIGFLMMG
LLYMERIRLTEHIAFKKRLIIKWFLPLALFICASVVFGLAAPKSDPNWPDPVPFLKKITN
HKEVPAAESKIGYGNHDETLGGPFQQDDTPVFTWKGKERSYFRVETKDTYTGKGWVETDQ
GMSYKLNGGNVEDIWFDRSVQTRRYTAQVSIDENYLYNHVMYPIGLSNIKPKHSIQLEMN
GNTEQITPISEQVGNIRNMGRYTVTFHAPVFKLNDLRKVKVKRYREQNQFNDRYLQLPDS
VPERVRQLADRLTRDHHNMFDKAKAVEDYLGSSAFSYDTQDVAIPEHNQDYVDQFLFETK
RGYCDNFSSAMAVLLRSAGIPARWVKGYTSGEYKSAGDHNGHIYEVTNNNAHSWVEVYFP
DQGWVTFEPTKGFTNPTEFTSEQNQTAGKDSGSSAGNSDTPSDKQRQETKPEKEEAPKKR
EHSAAPHPVIRNNTAAQLWPYAAVIIVISAAAALAWLLRARWIPYAAAARLKRRTDEDVF
FDAYAALLRQLKRKGFSRGDGETLRDFAARIDEAYDTNDMSELTLRYERALYRRDNAAEL
WNESGQLWENIIKTR
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatgacgagaaccagggaagcaggctgagtctgctgctgttttattttctcgct
tttttattgttgtgggaatggctcaggccgctgcacaattttacggatacaaagcatacc
ggttttttcatcgtctttatcggtttggcatttctgctgtcattcttccggatgaggtgg
tacgtcaccgtgccgtcctgcattctgtttacgttgatcagtattcacatgctgttttat
aaagggtcggtttttcagccggaatggcttgcttcttttttacgggacgtgatgctgaat
gtccggcacatcggaaccggaagatggaatgatatgaacccgtcattccgcacactgctg
ttctttgtgcttttatggctgcttgtgtatttgctgcattattgggtgatctatcagcgg
aaaatcttattcttttttatcatgacggtggcgtatattaccgtacttgatacatttact
ccttatgatgccgcatacgccgtcatccggatcgtctttatcggctttttgatgatgggg
cttttgtatatggagcgcatccgcctgacagaacacatagcatttaaaaaaagattgatt
atcaaatggtttctgccgctggcgctgtttatctgcgcttccgtcgtgttcggtctggcg
gctccgaaatcagatccgaattggccggaccccgtgccgtttctaaaaaaaataacaaat
cacaaagaagtgcccgccgctgaaagcaaaatcggctacggcaatcatgatgaaacattg
ggcggcccttttcagcaggacgatacgccggtttttacatggaagggaaaagagcggtcg
tacttccgggtggaaacgaaagatacatatacgggaaaaggctgggtggagaccgaccag
ggcatgtcctataaactgaacggcggcaatgtggaagacatatggtttgatcggagtgtg
cagacgagacgctatacggcgcaggtgtccattgatgaaaattatctttataatcacgtc
atgtatccgatcggcctctccaatattaaaccgaagcactcgattcagcttgaaatgaac
ggaaacaccgagcaaatcacgccgatcagtgaacaagtgggcaacatccgcaatatggga
cggtacacggtgacttttcacgcgcccgtctttaagctgaatgatctcagaaaagtgaaa
gtgaaacgataccgtgagcagaaccaatttaatgatcggtatttacagcttccggacagc
gttccggaaagagtgagacagcttgcggacaggctgacgcgggatcatcataatatgttt
gataaagcgaaggccgtcgaggactatctgggatcttccgcattttcgtatgatacgcag
gatgttgccattccggagcacaatcaggattatgtcgatcaatttctgtttgaaacgaaa
agaggatattgtgataacttttcatcggctatggccgtgctgctccgatctgcgggaatt
cccgcccgctgggtgaagggttatacatccggcgagtataaaagcgcaggcgaccataac
ggccacatttatgaagtcacaaacaacaacgcccattcgtgggttgaagtgtattttccc
gatcagggctgggtgacgtttgagccgacgaaaggcttcaccaatccgacggagtttacg
tcagagcaaaatcaaacagctggaaaagacagcggaagctcagcggggaattcggataca
ccgtctgacaagcagcgtcaggaaacaaagcctgaaaaagaagaagcgccgaaaaagcgg
gagcacagtgcggcaccgcatcctgtgatccgcaacaataccgcggcacagctgtggccg
tatgcagccgtcatcatcgtgatttctgccgcggcggcgctcgcctggctgctccgcgcg
cgctggattccgtacgctgcagcagccagactgaagcggcgcacggatgaagacgtcttt
ttcgacgcatatgccgcgctgctccgccagctgaaacgaaaaggattcagcagaggagac
ggagaaacgctgcgcgattttgccgcgaggattgacgaggcatacgatacaaacgacatg
tccgagctgacgctgcgctatgagcgggccttataccgcagggataatgccgcggagctt
tggaatgaatcgggacagttgtgggaaaatataattaaaacaagatag

DBGET integrated database retrieval system