KEGG   Bacillus sp. SDLI1: AUL54_13050Help
Entry
AUL54_13050       CDS       T05207                                 

Gene name
rbsC
Definition
(GenBank) ribose ABC transporter permease
  KO
K10440  ribose transport system permease protein
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AUL54_13050 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacs02000]
    AUL54_13050 (rbsC)
Transporters [BR:bacs02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    AUL54_13050 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 DUF2484
Motif
Other DBs
NCBI-ProteinID: AME07192
UniProt: A0A120KSW6
LinkDB All DBs
Position
complement(2697860..2698831)
Genome map
AA seq 323 aa AA seqDB search
MKTEPMTSIEQKRFSIHTFTQKLGPFLGLLILVLIVSVLNPSFLEPLNILNLLRQVAINA
LIAFGMTFVILTGGIDLSVGAILALSSAMIAGMMVSGIDPILAVIIGCVIGAVLGMINGL
LITKGKMAPFIATLATMTVFRGLTLVYTDGNPITGLGTNDAFQLFGRGYFLGIPVPAITM
LIAFAALWVLLHKTPFGRRTYAIGGNEKAALISGIKVPRIKIMIYSLTGLLSALAGAILT
SRLNSAQPTAGESYELDAIAAVVLGGTSLSGGRGRIIGTLIGVLIIGTLNNGLNLLGVSS
FYQLVVKGIVILIAVLLDRKKSA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgaaccaatgacttcaattgaacaaaagcgtttttccattcatacctttacg
caaaaactcggtccgtttctcggcttactgattcttgtgctgatcgtttccgttttaaac
ccgagttttcttgaacccctcaatattctgaaccttcttcggcaggttgcgattaacgcg
ctgatcgctttcggaatgacgtttgtcattttaacgggaggcattgatctctctgtcgga
gccatcctcgccttatcgagcgcaatgatcgccggtatgatggtatcaggcatcgacccg
atcttagccgttatcatcggctgcgtgatcggcgccgtactcggcatgataaacggttta
ttaatcacaaaaggaaaaatggctccgtttatcgccactttggcgacaatgacggtcttt
cgcggactgaccctcgtctatacggacggaaatccgattacgggactcggtacaaatgac
gcgtttcaattattcgggcgcggttattttctcggcatccccgtacccgccattaccatg
ctgattgcattcgcggccctatgggttcttctgcacaaaacaccgttcggccgccggaca
tacgccatcggcggcaatgagaaagcggcgctgatttccggtatcaaagtgccccgcatc
aagatcatgatctattctctgacaggtttattatcggcgctggccggagcgattctgaca
tcacgcttaaattccgcacagccgacggccggggaatcatacgagctggacgctatcgca
gcggtcgtactcggcggaacgagcctgtccggcggacggggacgcatcatcggtacgctg
atcggggttttgattatcggaacgctgaacaacggcttgaaccttctcggcgtatcgtct
ttttatcagctcgtcgtcaaaggaatcgtcattttaattgcggtgctgctggaccgcaaa
aaatcggcatag

DBGET integrated database retrieval system