KEGG   Bacillus sp. SDLI1: AUL54_13565Help
Entry
AUL54_13565       CDS       T05207                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00340  Histidine metabolism
bacs01100  Metabolic pathways
bacs01110  Biosynthesis of secondary metabolites
bacs01230  Biosynthesis of amino acids
Module
bacs_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AUL54_13565
Enzymes [BR:bacs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     AUL54_13565
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     AUL54_13565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AME07293
UniProt: A0A0X8KHN1
LinkDB All DBs
Position
2809759..2810379
Genome map
AA seq 206 aa AA seqDB search
MKQADELRFDEAGLIPAIVQDAASKEVLTLAYMNRESYEKTIETKETWFYSRSRGELWHK
GATSGNTQKVKAIRYDCDQDALVVLAEPSGPACHKGSYSCFSPEKADAQDRFGILNELES
VIAKRQAEMPEGAYTTYLFREGVDKILKKVGEEAAEVIIAAKNRDHEELKWEAADLLYHL
LVLLREQSLPLDDVLDVLAKRHSASE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcagatgaactgcggtttgacgaggccggactgattcccgccatcgtgcag
gatgcggcaagcaaagaagtgctgacactggcttatatgaatcgtgaatcctacgaaaaa
acgatagaaacgaaagaaacctggttttacagccgttcacgcggggagctgtggcataaa
ggagcgacgtcggggaatacccaaaaggtgaaagccatccgctatgattgcgatcaagat
gcccttgtcgtgcttgcggagccttcaggacctgcatgccataagggaagctacagctgc
ttttctccggaaaaagcggacgcgcaggatcgtttcggcatcttaaacgaactggaaagc
gtaatcgccaaacggcaggcggagatgcctgagggagcctacacaacgtatctgtttcgg
gaaggtgtcgataaaattctcaaaaaagtcggcgaagaagccgcagaggtgatcatcgcc
gcgaaaaaccgcgaccatgaagaattaaaatgggaagcggcagatttgctgtatcatttg
ctcgttcttctgcgtgaacagtcgcttcctttagacgacgtgcttgacgttcttgcgaaa
cgccattcagcatctgagtaa

DBGET integrated database retrieval system