KEGG   Bacillus sp. SDLI1: AUL54_14595Help
Entry
AUL54_14595       CDS       T05207                                 

Definition
(GenBank) tautomerase
Organism
bacs  Bacillus sp. SDLI1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase_2 Tautomerase
Motif
Other DBs
NCBI-ProteinID: AME07481
UniProt: A0A109WFT5
LinkDB All DBs
Position
3009960..3010340
Genome map
AA seq 126 aa AA seqDB search
MPFVQIHLQKGKSGLWLKKMSAVIHTAMTEMIDVPHDDYFQVVHQHEKGEFFYDPSYLQV
ERSDELMFIRVTLKNSRTTHQKQAFYQHLADRLHEKLGVRKEDVFIVLSGNAAEDWSFGN
GEAQMI
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgtacagatccatttacagaaagggaaaagcggactttggcttaaaaaaatg
agcgccgttattcacactgcgatgacggagatgattgatgttccgcatgatgactatttt
caagtggtgcatcagcacgaaaaaggggagtttttctatgatccgtcatatcttcaagtc
gagcggagcgatgaactgatgtttatccgcgtcactttgaaaaactccagaacaactcat
cagaaacaagcattctatcagcatttggctgaccggctgcacgaaaagctgggcgtcaga
aaagaagatgtgtttatcgtcctctcaggcaatgcggcggaagactggtcattcggaaac
ggagaggcccagatgatataa

DBGET integrated database retrieval system