KEGG   Bacillus sp. SDLI1: AUL54_14605Help
Entry
AUL54_14605       CDS       T05207                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
bacs  Bacillus sp. SDLI1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 Fe_dep_repress HTH_34 HTH_27 HTH_24 Rrf2 TrmB Penicillinase_R HTH_5 HxlR LexA_DNA_bind FeoC B-block_TFIIIC HTH_47 GntR HTH_Crp_2 HTH_DeoR HTH_IclR DUF2250 PadR TnsD HTH_29 CheB_methylest
Motif
Other DBs
NCBI-ProteinID: AME07483
UniProt: A0A0X8KI42
LinkDB All DBs
Position
complement(3011992..3012453)
Genome map
AA seq 153 aa AA seqDB search
MKNADQYVSDIQKSLQTLLQNIQPEMMESMAKHEVTPAQLFVLASLKKQGSCKVSEIAER
MEVKPSAVTLMADRLEQKGLIVRKHNQQDRRVIDISLTEKGEKKFEDVVEGRKAILARNL
SVLTDDELIQSVNIIRKVAEAAEKYAVDQKENE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcggatcaatatgtgtctgacatccaaaaatcccttcagacgctgctgcaa
aacatacagccggaaatgatggaaagcatggcaaaacatgaggtgactcctgcccaatta
tttgttttagccagcttaaaaaaacaaggcagctgcaaagtttccgaaattgcggagcgc
atggaagtaaagccgagcgcagtgacgctgatggccgaccgccttgagcaaaaaggactg
atcgtccgcaaacataatcagcaggacagacgtgtcatcgacatcagccttaccgaaaaa
ggcgagaagaaattcgaggatgtcgtggaaggaagaaaagcgatattagcgcgaaacctg
tccgttctgactgacgatgaactgattcagtccgtgaacatcatccgcaaagtagcggaa
gccgccgagaaatacgcggttgaccaaaaagaaaacgaatag

DBGET integrated database retrieval system