KEGG   Bacillus sp. SDLI1: AUL54_14635Help
Entry
AUL54_14635       CDS       T05207                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00071  Fatty acid degradation
bacs00280  Valine, leucine and isoleucine degradation
bacs00281  Geraniol degradation
bacs00362  Benzoate degradation
bacs00592  alpha-Linolenic acid metabolism
bacs01100  Metabolic pathways
bacs01110  Biosynthesis of secondary metabolites
bacs01120  Microbial metabolism in diverse environments
bacs01130  Biosynthesis of antibiotics
bacs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AUL54_14635
   00592 alpha-Linolenic acid metabolism
    AUL54_14635
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AUL54_14635
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AUL54_14635
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AUL54_14635
   00642 Ethylbenzene degradation
    AUL54_14635
Enzymes [BR:bacs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AUL54_14635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AME07489
UniProt: A0A0X8KI57
LinkDB All DBs
Position
3016934..3018109
Genome map
AA seq 391 aa AA seqDB search
MREAVIVAGARTPVGKAKKGSLAAVRPDDLGALCVKETLKRAGGYEGNIDDLIIGCATPE
AEQGLNMARNIGALAGLPHTVPAITVNRYCSSGLQSIAYGAEKIMIGAGDTVIAGGAESM
SQVPMMGHVTRPNIALAEHAPEYYMSMGHTAEQVAETYGVSREDQDAFAVRSHQNAAKAL
KEGKFNDEIVPVEVSLTEAGDDHKPRKKQFTFSQDEGVRPGTSADVLAKLRPAFSKTGTV
TAGNSSQTSDGAAAVMLMDREKASSLGLAPLVKFRSFAVGGVPPEVMGIGPIEAIPRALK
LAGLELQDIGLFELNEAFASQAIQVIRSLGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL
IHEMKRRNEQFGVVTMCIGGGMGAAGVFELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtcattgtggccggtgcgagaacgccggtcggtaaagcgaaaaaaggg
tcgcttgcagccgttcgtcctgatgatttaggcgcgctttgtgtgaaagaaacgctgaaa
cgggcaggcggctatgaaggaaacatcgatgacttaattatcggatgtgcaacacctgaa
gccgaacaaggattaaatatggcgcggaatatcggtgcgctggcggggcttcctcatacg
gtgccggccattacggtgaaccgctactgctcttccggacttcaatccatcgcttacggt
gcggaaaaaattatgatcggcgcgggcgacaccgtcatcgccggcggggcggaatccatg
tcgcaagttccgatgatggggcatgtgacccgcccgaatatcgctttggcggagcatgcg
cctgagtattacatgagtatggggcacacagcggagcaggtcgccgaaacatacggcgta
tccagagaagaccaggatgcatttgccgtccgcagccatcaaaatgccgcgaaagccctt
aaagaagggaaatttaatgacgaaatcgtgccggttgaagtatcgctgacagaagccggg
gatgaccataagccgcggaaaaaacaatttaccttttctcaagatgaaggcgtgcgcccc
ggcacatcggctgacgtattggcaaagctccgtccggctttttctaaaacgggaaccgtg
acggccgggaactcttcacaaacgagtgacggcgcggctgctgtcatgctgatggatcgc
gaaaaagcttcgtcgctcggattggcgccgctagtcaaattccgttcctttgccgtaggc
ggcgttccccctgaggtcatggggatcggtccgattgaagctattccgcgggcgctcaag
cttgccggactcgaattgcaggatatcgggctttttgaattgaatgaggcctttgcttca
caggccattcaagttatcagatcactgggaatagatgaagaaaaggtgaacgtcaatggg
ggcgccatcgcgctcggacatccgctcggctgcacggggacgaagctgaccctgtcactc
attcatgaaatgaaacggagaaacgagcaattcggcgtggtgacgatgtgcatcggaggc
ggcatgggcgctgccggcgtatttgagctcatttaa

DBGET integrated database retrieval system