KEGG   Bacillus sp. SDLI1: AUL54_15225Help
Entry
AUL54_15225       CDS       T05207                                 

Definition
(GenBank) hypothetical protein
Organism
bacs  Bacillus sp. SDLI1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WXG100 T7SS_ESX_EspC PPE Rho_N Serine_rich DUF5082 LXG BLOC1_2 UPF0449 DUF5344 Mer2 FapA KxDL Sec34 DUF5129 BshC Beach Frankia_peptide Zw10 DUF948 DUF4473
Motif
Other DBs
NCBI-ProteinID: AME07595
UniProt: A0A0X8KI87
LinkDB All DBs
Position
3130676..3130969
Genome map
AA seq 97 aa AA seqDB search
MSGLIRVTPEELRAMAKQYGVESQEVMNQVDRLNRMISDLKGMWEGASSEAFADQYEQLK
PSFIKMSELLQDVNHQLDQTANTLESTDQDIANQIRG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgtctggattaattcgtgtcacacccgaagagctaagagcgatggctaagcaatatggc
gttgaaagtcaggaagtcatgaatcaggttgaccgcctgaaccgcatgatttctgatttg
aaaggcatgtgggaaggtgcttcaagtgaagcattcgcggatcaatatgagcagctgaaa
ccttcatttattaaaatgtctgaattgcttcaagatgtgaatcatcagctcgatcaaacg
gcaaatacgcttgagtctactgaccaagatatcgctaaccaaattcgcggataa

DBGET integrated database retrieval system