KEGG   Bacillus sp. SDLI1: AUL54_16660Help
Entry
AUL54_16660       CDS       T05207                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00010  Glycolysis / Gluconeogenesis
bacs00030  Pentose phosphate pathway
bacs00051  Fructose and mannose metabolism
bacs00052  Galactose metabolism
bacs00680  Methane metabolism
bacs01100  Metabolic pathways
bacs01110  Biosynthesis of secondary metabolites
bacs01120  Microbial metabolism in diverse environments
bacs01130  Biosynthesis of antibiotics
bacs01200  Carbon metabolism
bacs01230  Biosynthesis of amino acids
bacs03018  RNA degradation
Module
bacs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bacs_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AUL54_16660
   00030 Pentose phosphate pathway
    AUL54_16660
   00051 Fructose and mannose metabolism
    AUL54_16660
   00052 Galactose metabolism
    AUL54_16660
  09102 Energy metabolism
   00680 Methane metabolism
    AUL54_16660
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AUL54_16660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bacs01009]
    AUL54_16660
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bacs03019]
    AUL54_16660
Enzymes [BR:bacs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AUL54_16660
Protein phosphatases and associated proteins [BR:bacs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AUL54_16660
Messenger RNA biogenesis [BR:bacs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AUL54_16660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AME07834
UniProt: A0A0X8KIS1
LinkDB All DBs
Position
3396086..3397045
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLINGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKRLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMEEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLKGKGGRCVGIQNNKLVDHDIIEIL
ESKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagtattaacgagcggcggggattccccggggatgaacgcagcggtg
cgagcggttgtgcgtaaagctatctatcacgatgtagaagtttacggaatttataacggt
tattcaggattaatcaacggaaaaatagagaaactggagcttggttcggtcggtgacatc
atccaccgcggaggaacaaagctgtatacagccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagagactcggcattgaaggtcttgtcgtgatc
ggcggagacggttcgtacatgggtgcgaaaaaattaacggaacacgggtttccgtgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaataccgtaattgatgcgattgataaaatccgtgacacagctacgtcgcat
gagcgtacatacgtaattgaagtgatgggacgccatgcaggcgacattgctttatgggca
ggtcttgcaggcggagcggaatccattttaatccctgaagcggactacgatatggaggaa
attatcggccgtttgaagagagggcacgaccgcggcaaaaaacacagtatcatcatcgtt
gctgagggggtaggcagcggggttgaattcggaaaacgcatcgaagaagaaacaaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttaaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gaatcaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system