KEGG   Bacillus sp. SDLI1: AUL54_16690Help
Entry
AUL54_16690       CDS       T05207                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00020  Citrate cycle (TCA cycle)
bacs00480  Glutathione metabolism
bacs01100  Metabolic pathways
bacs01110  Biosynthesis of secondary metabolites
bacs01120  Microbial metabolism in diverse environments
bacs01130  Biosynthesis of antibiotics
bacs01200  Carbon metabolism
bacs01210  2-Oxocarboxylic acid metabolism
bacs01230  Biosynthesis of amino acids
Module
bacs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AUL54_16690
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AUL54_16690
Enzymes [BR:bacs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AUL54_16690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AME07840
UniProt: A0A109WFZ6
LinkDB All DBs
Position
3402659..3403930
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSEAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLVIKAMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
attatcccgtttattgaaggcgacggcacaggccctgatatttggaatgccgcttctaaa
gtattggaagccgctgttgaaaaagcatataaaggcgagaaaaaaatcacgtggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgagtggcttcctgccgaaacgctg
gaagacatcagagagtacttcatcgctatcaaaggacctctgacgacaccggtcggcggc
ggtatccgttctctgaacgtggcgctgagacaggagcttgatttgtttacgtgcctgcgc
cctgtcagatatttcactggagtgccttctccggtcaaacgtcctgaagatacggatatg
gtcattttccgcgaaaatacggaagatatttacgccggaattgagtatgcgaaaggttct
gaagaagttgaaaagctgatcagcttcctgcaaaatgaaatgggcgttaacaaaatccgt
ttccctgaaacatcaggaatcggcataaagcctgtttctgaagaaggaacaagccgctta
gtcagagctgccattgagtatgcgatcgaaaacggccgcaagtctgtcacgcttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctatgagcttgcc
gaaagagaatacggagataaagtattcacttgggccgaatatgaccgcatcgtcgaaaaa
gacggaaaagaagcggctgataaagcgcagagcgaagcagaagcagcaggaaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttaacccgtccgagtgaattc
gacgtcgtggcgacgatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacagggcatgcgatt
ttcgaagcgactcacggaacggctcctaaatatgccggccttgacaaagtcaacccgtca
tccgttatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggcggctgac
ctagtcattaaagctatggaaaaaacgattgcttcaaaagtagtaacttacgattttgca
agattaatggacggtgcaactgaagtgaaatgttcagagttcggtgaagagcttatcaaa
aacatgggctga

DBGET integrated database retrieval system