KEGG   Bacillus sp. SDLI1: AUL54_18190Help
Entry
AUL54_18190       CDS       T05207                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bacs  Bacillus sp. SDLI1
Brite
Enzymes [BR:bacs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AUL54_18190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AME08112
UniProt: A0A109WG79
LinkDB All DBs
Position
3702695..3703300
Genome map
AA seq 201 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVEELVADL
NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFAA
AAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVARLYSEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaactgccttacgcttatgatgctttagaaccgcatatcgat
aaggaaacgatgacgattcaccacacgaagcaccataacacatacgttacaaacctgaac
aaagcgatcgaaggatcagctcttgcagagaaatctgtagaagagcttgtcgctgattta
aacgcagtgccggaggatatccgcacagctgtccgcaacaatggcggcggacatgcaaac
cactctttattctggactcttttatctccaaacggcggaggcgaaccgactggtgagctt
gctgaagagatcaaaagcacgttcggaagcttcgatcaatttaaagaaaaattcgctgca
gcggctgccggccgtttcggttccggctgggcttggcttgttgtaaacaacggcaaactt
gaaattacaagcacgccaaaccaagattcaccgctttcagaaggtaaaacgcctgtcctc
ggtcttgatgtttgggagcacgcttactacctgaactaccaaaaccgccgtcctgattac
atttcagctttctggaatgttgtaaattgggatgaagttgcccgcctttacagcgaagca
aaataa

DBGET integrated database retrieval system