KEGG   Bacillus sp. SDLI1: AUL54_19615Help
Entry
AUL54_19615       CDS       T05207                                 

Definition
(GenBank) spore coat protein
Organism
bacs  Bacillus sp. SDLI1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YppG
Motif
Other DBs
NCBI-ProteinID: AME08386
UniProt: A0A0X8KJW3
LinkDB All DBs
Position
4012750..4013220
Genome map
AA seq 156 aa AA seqDB search
MQWRAQPYQNMYQQPAGYVYPQQIQPLQQPNQQPMQPLQPQPYPQQIQPLQPPPYHQQGQ
FPPQFYPNQEYGHMQQPYTPAPPQAGMPGGPPGFVNPYPVPRPNQQQPSQFSGILSQFKK
TNGQFDFNKMIDTTGQMVSAVNQVGSLVKGFTSIFK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcaatggagagcgcagccgtatcaaaatatgtaccagcagccggcgggatatgtctat
ccgcagcagatacagccgctgcagcagccgaatcagcagccgatgcagccattacagccg
cagccgtatccgcagcaaatacagccattgcagccgccgccgtatcatcagcaagggcag
tttccgccgcaattttatccgaatcaggaatacggtcatatgcagcagccgtacactccc
gccccgcctcaggcaggcatgcccggggggccgccgggatttgtgaatccttaccccgtt
cccagaccgaatcagcagcagccttcccaattctcagggatactctcacagtttaaaaag
acaaatggacagtttgactttaataaaatgatagatacaacggggcagatggtaagcgcc
gtaaaccaggtcggatcgctggtgaaaggatttaccagtatctttaaataa

DBGET integrated database retrieval system