KEGG   Bifidobacterium actinocoloniiforme: AB656_06020Help
Entry
AB656_06020       CDS       T04036                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bact  Bifidobacterium actinocoloniiforme
Brite
KEGG Orthology (KO) [BR:bact00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bact01001]
    AB656_06020
Enzymes [BR:bact01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AB656_06020
Protein kinases [BR:bact01001]
 Serine/threonine kinases: Other
  Bacterial family
   AB656_06020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr ETRAMP APH Pkinase_fungal RIO1 Seadorna_VP7 Kinase-like Haspin_kinase Kdo FTA2
Motif
Other DBs
NCBI-ProteinID: AKV55790
UniProt: A0A086YWE0
LinkDB All DBs
Position
complement(1461136..1463292)
Genome map
AA seq 718 aa AA seqDB search
MSIALPASLANGRYQLGQLIGRGGMAEVYTALDTRLGRTVAVKIMRSDLTNDEIFLTRFK
REAHSVAQLNNPNIVSIYDSGEELLVEEAGNQERVPYLVMEYVKGQTLRAIIKANGALSQ
RDAEQVMLGVLNALEYSHHMGIIHRDIKPGNIMISEQGVVKVMDFGIARALDDSAATMTQ
SQGVVGTAQYLSPEQARGENVDMRSDLYSAGCVLYEMLTGRPPFNGDSAVAIAYQHVSEV
ATPPSAIVPGLPKMWDSICAKAMAKDRGNRYATASGFKNDIMTFMNGGTPVAAAFNPLAD
LANMKARKAAEEEAATAALPPTGDETAATQAMSPLGPANQPLAGATAQTVAQAQSRKAAN
AKKRKKKIIISSIAAILALALIGLGAWGFLNRDKRDETTVPTINAQMSKLLAREKVTAAG
FKYEEKEDPDSAEPAGTFTHQNPKGGVQAKKGSTVTVWFSSGPQSTKIPDVKGLSQDDAR
DKLEKAGFKVSPSASIEDSPDVPKNQVTRTDPAGGQSVPKGSSILIYISSGMTKVPDVSG
KTLDEAKAMLQHFNITVQKQHSDTVAKDSVIYTDPAANTSVAQGAMVTVNVSDGMAVKDV
NGKTLGEAKQILAGIKISVNGPSDDSAIVTGQTPGAGSAIKKDTDTVTLTTEPGNATVPP
FDSTTTLGSYKAQLSAAGLNNYALHGPSDGSAKVTAVSPGPGSSVDKNTQINITTSSN
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcactaccagcctccctggcgaacgggcgctaccagcttggccagcttatc
ggccgcggcggcatggccgaagtctacaccgcgctcgacacccgcttgggccgcacagtc
gcggtcaaaatcatgcgctcggacttgaccaacgacgagatcttcctaacccgtttcaag
cgtgaagcccactcggtggcccagttgaacaaccccaacatcgtctcgatttacgactcg
ggcgaggagctcctggtcgaagaggccggcaaccaggagcgcgtgccctacctagtgatg
gagtacgtcaagggccagaccctgcgcgccatcatcaaggccaacggcgccctgagccag
cgcgacgccgagcaggtgatgctgggtgtcctgaacgccttggaatactcccaccacatg
ggcatcatccaccgcgacatcaagcccggcaacatcatgatctccgagcaaggcgtcgtc
aaggtcatggacttcggcatcgcccgggccctggacgactccgccgccacgatgacccag
tcccagggcgtggtcggcaccgcccagtacctgagcccggaacaggcccggggcgagaac
gtggacatgcgctccgacctgtactcggccggctgcgtcctctacgagatgctgaccggg
cgcccacccttcaacggtgactccgcggtggctatcgcctaccagcacgtctccgaggtg
gccacgccaccttccgccatcgtgcccggcttgcccaagatgtgggattcaatctgcgcc
aaagccatggccaaggaccgggggaaccgctacgcgacggcctccgggttcaagaacgac
atcatgaccttcatgaacggcggcacccccgtggccgccgccttcaacccactcgccgat
ctggcgaacatgaaggcacgcaaggccgccgaggaggaggccgccacggcggccctgccc
ccgaccggcgacgagaccgcagccacccaggccatgagccccttaggcccggccaatcag
cccttggccggcgcgaccgcccagacggtggcccaggcccagagccgcaaggccgccaat
gccaagaagcgcaagaagaaaatcatcatctcctcgatcgccgccatcctggccttggcg
ctgataggcctgggcgcatggggcttcctcaaccgcgacaagcgcgacgagaccaccgta
cccacaatcaacgcgcagatgtccaagctcctggcccgggaaaaggtcacggctgccggc
ttcaagtacgaggagaaagaggaccccgactcggccgagccggcgggcaccttcacccac
caaaaccccaagggcggcgtccaggccaagaagggttccacggtcacggtctggttctcc
tccggcccccagtccactaagatcccggacgtcaagggcctgagccaggacgacgcgcgc
gacaaattggaaaaagccgggttcaaagtcagcccctccgcttcgattgaggattcgccg
gacgtgccgaagaaccaggtgacccgcaccgatccggccggtggccagtccgtgcccaag
ggctcctcaatcctcatctacatctcctcgggcatgaccaaggtgccggacgtgtcaggc
aagaccctggacgaggccaaggccatgctccagcacttcaacatcacggtccagaagcag
cactcggacaccgtggccaaggactcggtcatctacaccgatccggcggccaacacctcc
gtagcccaaggagcgatggttaccgtcaacgtctcggacggcatggccgtcaaagacgtg
aacggcaagaccctgggcgaggccaagcaaatcctggcgggcatcaaaatcagcgtgaac
ggcccctcggacgactcggccatcgtgaccgggcagaccccgggcgcgggctccgcgatc
aagaaggacaccgatacggtcaccttgaccaccgaaccaggcaatgccaccgtgcccccc
ttcgactccaccaccacgctcggctcctacaaggcccagctcagcgcagcggggctgaac
aactacgccctccacggcccctcggatggcagcgccaaagtcaccgcggtcagccccggc
cccggcagctcggtcgacaagaacacgcaaatcaacatcaccacttcctccaattag

DBGET integrated database retrieval system