KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997242
Entry
102997242         CDS       T03086                                 

Gene name
FOS
Definition
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04024  cAMP signaling pathway
bacu04210  Apoptosis
bacu04380  Osteoclast differentiation
bacu04620  Toll-like receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04668  TNF signaling pathway
bacu04713  Circadian entrainment
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04932  Non-alcoholic fatty liver disease
bacu04935  Growth hormone synthesis, secretion and action
bacu05031  Amphetamine addiction
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05224  Breast cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05323  Rheumatoid arthritis
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102997242 (FOS)
   04668 TNF signaling pathway
    102997242 (FOS)
   04024 cAMP signaling pathway
    102997242 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102997242 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102997242 (FOS)
   04660 T cell receptor signaling pathway
    102997242 (FOS)
   04658 Th1 and Th2 cell differentiation
    102997242 (FOS)
   04659 Th17 cell differentiation
    102997242 (FOS)
   04657 IL-17 signaling pathway
    102997242 (FOS)
   04662 B cell receptor signaling pathway
    102997242 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102997242 (FOS)
   04917 Prolactin signaling pathway
    102997242 (FOS)
   04921 Oxytocin signaling pathway
    102997242 (FOS)
   04926 Relaxin signaling pathway
    102997242 (FOS)
   04935 Growth hormone synthesis, secretion and action
    102997242 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    102997242 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    102997242 (FOS)
   04728 Dopaminergic synapse
    102997242 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102997242 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102997242 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997242 (FOS)
   05231 Choline metabolism in cancer
    102997242 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102997242 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102997242 (FOS)
   05224 Breast cancer
    102997242 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102997242 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    102997242 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102997242 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102997242 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102997242 (FOS)
   05135 Yersinia infection
    102997242 (FOS)
   05133 Pertussis
    102997242 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102997242 (FOS)
   05170 Human immunodeficiency virus 1 infection
    102997242 (FOS)
   05161 Hepatitis B
    102997242 (FOS)
   05171 Coronavirus disease - COVID-19
    102997242 (FOS)
   05162 Measles
    102997242 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102997242 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102997242 (FOS)
   05142 Chagas disease
    102997242 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102997242 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    102997242 (FOS)
   04131 Membrane trafficking [BR:bacu04131]
    102997242 (FOS)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    102997242 (FOS)
Membrane trafficking [BR:bacu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102997242 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 102997242
NCBI-ProteinID: XP_007184544
UniProt: A0A384AB83
LinkDB
Position
Un
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSSHHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTSSAGAYSRAGVMKTMNGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDMGFPEEMSVASLDLSGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVQSISSVELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc
tccccggccggggacagtctctcctcccaccactcaccggccgactccttctccagtatg
ggctctcccgtcaatgcgcaggacttctgcaccgatctggccgtctccagtgccaacttc
atcccgacagtgactgccatctcgaccagcccggacctgcagtggctagtgcagcccacc
ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccccacc
tcctcggctggggcttactccagggctggagtcatgaagaccatgaacggaggcagagct
cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaggagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccgaaggagggag
ctgactgacacactccaagcggaaacagaccaactagaagatgagaagtctgctttgcag
actgagattgccaacctgctaaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacatgggcttcccagaagaaatgtctgtggcttcc
cttgatctgagcgggggcctgcctgaagctgccacccccgaatctgaggaggccttcacc
ctacccctccttaatgaccctgagcccaagccctcagtggagcccgtccagagcatcagc
agcgtggagctgaaggctgagccctttgatgacttcctgttcccagcatcgtccaggccc
agcggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca
gcagactgggagcccctgcacggtggctccctggggatggggcccatggccacagagctg
gaacccctgtgcaccccggtggtcacctgtacgcccagctgcactacttacacgtcttcc
ttcgtcttcacctaccctgaggctgactccttccccagctgtgcagctgcccaccgcaag
ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system