KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997405
Entry
102997405         CDS       T03086                                 

Definition
(RefSeq) signal transducer and activator of transcription 3-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04217  Necroptosis
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04630  JAK-STAT signaling pathway
bacu04659  Th17 cell differentiation
bacu04917  Prolactin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04931  Insulin resistance
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05145  Toxoplasmosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05212  Pancreatic cancer
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102997405
   04066 HIF-1 signaling pathway
    102997405
   04068 FoxO signaling pathway
    102997405
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102997405
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102997405
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102997405
   04062 Chemokine signaling pathway
    102997405
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102997405
   04917 Prolactin signaling pathway
    102997405
   04935 Growth hormone synthesis, secretion and action
    102997405
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997405
   05206 MicroRNAs in cancer
    102997405
   05205 Proteoglycans in cancer
    102997405
   05203 Viral carcinogenesis
    102997405
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102997405
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102997405
   05221 Acute myeloid leukemia
    102997405
   05223 Non-small cell lung cancer
    102997405
  09163 Immune disease
   05321 Inflammatory bowel disease
    102997405
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102997405
   04933 AGE-RAGE signaling pathway in diabetic complications
    102997405
  09172 Infectious disease: viral
   05161 Hepatitis B
    102997405
   05160 Hepatitis C
    102997405
   05171 Coronavirus disease - COVID-19
    102997405
   05162 Measles
    102997405
   05163 Human cytomegalovirus infection
    102997405
   05167 Kaposi sarcoma-associated herpesvirus infection
    102997405
   05169 Epstein-Barr virus infection
    102997405
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102997405
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102997405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    102997405
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102997405
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N Fib_alpha
Other DBs
NCBI-GeneID: 102997405
NCBI-ProteinID: XP_007177855
UniProt: A0A383ZRZ2
LinkDB
Position
Un
AA seq 783 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTXXXXXXXXXXXXXXLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNN
MSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLK
TKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECAT
SPM
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctggacacacggtacttggagcagcttcatcag
ctgtacagtgacagcttcccgatggagctacggcagtttctggccccttggatcgagagt
caagattgggcatatgcggccagcaaagaatcacatgcaactttggtgtttcataatctc
ttgggtgaaattgaccagcagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaacctgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctcctccagaccgcagcc
actgcagcccagcaagggggccaggccaaccatcccacggccgccgtggtgacggagaag
cagcaaatgctggagcagcacctacaggatgtccggaagcgtgtccaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactacaaaaccctcaag
agtcaaggagatatgcaagatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagctcgaacagatgcttactgcgctggaccagatgcggcgaagcatcgtgagtgag
ttggcagggcttttgtcagctatggagtacgtgcagaaaactctcacggatgaagagctg
gccgactggaagaggcggcagcagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattggcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcagaaagttagctacaaaggagatcccattgtacaa
caccggccaatgctggaggagagaatcgtagagctgtttagaaacttaatgaaaagtgcc
ttcgtggtagagcggcagccctgcatgcctatgcatcccgaccggccattagtcatcaag
accggtgtccagtttacaactaaagtcagattgctggtcaaattccctgagctaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggatgttgcagctctcagagga
tcccggaaatttaacatcctgggcacaaacacgaaagtgatgaacatggaagagtccaac
aacggcagcctctccgcagagttcaaacacttgaccctgagagagcagaggtgtggtaac
gggggccgagccaactgcgacgcctccctgattgtgactgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctagagacccactccttgcca
gttgtggtgatctccaacatctgtcagatgcccaacgcctgggcgtccatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccaattggaaca
tgggatcaagtggccgaggtgctgagctggcagttctcctccaccaccaagcgcgggctg
agcatcgagcagttgacaacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacgtgggctaaattttgcaaagaaaacatggccggcaagggcttctcc
ttctgggtctggctggacaatatcattgaccttgtgaaaaagtacatcctggccctttgg
aatgaagggtacataatgggctttatcagtaaggagagggagcgggccatcttgagcacc
aagcccccaggcaccttnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntcctg
ctgagattcagtgaaagcagcaaagaaggaggagtcaccttcacttgggtggagaaggac
atcagtggtaagacccagatccagtcggtggaaccgtacaccaagcagcagctgaacaac
atgtcgtttgctgaaatcatcatgggctataagatcatggatgccaccaatatcctggtg
tctccgctggtctacctctaccctgacattccaaaggaggaggcgttcggaaagtactgt
cggccagagagccaggagcatcccgaagccgacccgggtagtgctgccccatacctgaag
actaagttcatctgtgtgacaccaacgacctgcagcaataccattgacctgccgatgtcc
ccccgcactttagattcattgatgcagtttggaaataatggtgaaggtgctgaaccctca
gcaggagggcagtttgaatccctcacgttcgacatggagctgacctcggagtgcgctacc
tcccccatgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008157
Entry
103008157         CDS       T03086                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 (acute-phase response factor)
  KO
K04692  signal transducer and activator of transcription 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04217  Necroptosis
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04630  JAK-STAT signaling pathway
bacu04659  Th17 cell differentiation
bacu04917  Prolactin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04931  Insulin resistance
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05145  Toxoplasmosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05212  Pancreatic cancer
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103008157 (STAT3)
   04066 HIF-1 signaling pathway
    103008157 (STAT3)
   04068 FoxO signaling pathway
    103008157 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103008157 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103008157 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103008157 (STAT3)
   04062 Chemokine signaling pathway
    103008157 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103008157 (STAT3)
   04917 Prolactin signaling pathway
    103008157 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    103008157 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008157 (STAT3)
   05206 MicroRNAs in cancer
    103008157 (STAT3)
   05205 Proteoglycans in cancer
    103008157 (STAT3)
   05203 Viral carcinogenesis
    103008157 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103008157 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103008157 (STAT3)
   05221 Acute myeloid leukemia
    103008157 (STAT3)
   05223 Non-small cell lung cancer
    103008157 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103008157 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103008157 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103008157 (STAT3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103008157 (STAT3)
   05160 Hepatitis C
    103008157 (STAT3)
   05171 Coronavirus disease - COVID-19
    103008157 (STAT3)
   05162 Measles
    103008157 (STAT3)
   05163 Human cytomegalovirus infection
    103008157 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008157 (STAT3)
   05169 Epstein-Barr virus infection
    103008157 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103008157 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103008157 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103008157 (STAT3)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103008157 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 DUF4795 E2R135 Fib_alpha Syntaxin-6_N
Other DBs
NCBI-GeneID: 103008157
NCBI-ProteinID: XP_007177896
LinkDB
Position
Un
AA seq 769 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSG
DVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVT
EELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFF
TKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKEN
MAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLXXXXX
XXXXXXXLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctggacacacggtacttggagcagcttcatcag
ctgtacagtgacagcttcccgatggagctacggcagtttctggccccttggatcgagagt
caagattgggcatatgcggccagcaaagaatcacatgcaactttggtgtttcataatctc
ttgggtgaaattgaccagcagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaacctgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctcctccagaccgcagcc
actgcagcccagcaagggggccaggccaaccatcccacggccgccgtggtgacggagaag
cagcaaatgctggagcagcacctacaggatgtccggaagcgtgtccaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactacaaaaccctcaag
agtcaaggagatatgcaagatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagctcgaacagatgcttactgcgctggaccagatgcggcgaagcatcgtgagtgag
ttggcagggcttttgtcagctatggagtacgtgcagaaaactctcacggatgaagagctg
gccgactggaagaggcggcagcagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattggcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcagaaagttagctacaaaggagatcccattgtacaa
caccggccaatgctggaggagagaatcgtagagctgtttagaaacttaatgaaaagtccc
gaccggccattagtcatcaagaccggtgtccagtttacaactaaagtcagattgctggtc
aaattccctgagctaaattatcagcttaaaattaaagtgtgcattgacaaagactccggg
gatgttgcagctctcagaggatcccggaaatttaacatcctgggcacaaacacgaaagtg
atgaacatggaagagtccaacaacggcagcctctccgcagagttcaaacacttgaccctg
agagagcagaggtgtggtaacgggggccgagccaactgcgacgcctccctgattgtgact
gaggagctgcacctgatcacctttgagactgaggtgtatcaccaaggcctcaagattgac
ctagagacccactccttgccagttgtggtgatctccaacatctgtcagatgcccaacgcc
tgggcgtccatcctgtggtataacatgctgaccaacaaccccaagaacgtgaactttttc
accaagcccccaattggaacatgggatcaagtggccgaggtgctgagctggcagttctcc
tccaccaccaagcgcgggctgagcatcgagcagttgacaacgctggcggagaaactctta
ggacctggtgtgaactattcagggtgtcagatcacgtgggctaaattttgcaaagaaaac
atggccggcaagggcttctccttctgggtctggctggacaatatcattgaccttgtgaaa
aagtacatcctggccctttggaatgaagggtacataatgggctttatcagtaaggagagg
gagcgggccatcttgagcaccaagcccccaggcaccttcctgctnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnngctgagattcagtgaaagcagcaaagaaggaggagtcacc
ttcacttgggtggagaaggacatcagtggtaagacccagatccagtcggtggaaccgtac
accaagcagcagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccgctggtctacctctaccctgacattccaaaggag
gaggcgttcggaaagtactgtcggccagagagccaggagcatcccgaagccgacccgggt
gctgccccatacctgaagactaagttcatctgtgtgacaccaacgacctgcagcaatacc
attgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataatggt
gaaggtgctgaaccctcagcaggagggcagtttgaatccctcacgttcgacatggagctg
acctcggagtgcgctacctcccccatgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015475
Entry
103015475         CDS       T03086                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A-like
  KO
K11223  signal transducer and activator of transcription 5A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04012  ErbB signaling pathway
bacu04217  Necroptosis
bacu04630  JAK-STAT signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04917  Prolactin signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103015475
   04630 JAK-STAT signaling pathway
    103015475
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103015475
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103015475
   04659 Th17 cell differentiation
    103015475
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103015475
   04935 Growth hormone synthesis, secretion and action
    103015475
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015475
   05203 Viral carcinogenesis
    103015475
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103015475
   05220 Chronic myeloid leukemia
    103015475
   05223 Non-small cell lung cancer
    103015475
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103015475
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103015475
   05161 Hepatitis B
    103015475
   05162 Measles
    103015475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103015475
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103015475
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 103015475
NCBI-ProteinID: XP_007177741
UniProt: A0A383ZRV2
LinkDB
Position
Un
AA seq 794 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRPQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSSSGILVDAMSQKHLQINQTLEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
GSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVSASADSAGGSATY
MDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPRLS
PPTGLFTSARGSLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgcgcttcgccagatgcaggtg
ctgtatgggcaacactttcccatcgaggtccggcattacctagcgcagtggatcgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgaccccaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcattacgccacgcagctccagaacacgtatgaccgc
tgccccatggaattggtgcgctgcatccgccatattctgtacaatgaacaaaggctggtc
cgagaagccaacaatggtagttcttcttctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacacttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccaatatcaagagagcctg
aggatacaggctcagtttgcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggacgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagctgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
acagacatcatctcagccctggtgaccagcacgttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tcgctgctcaagaacgagaacacccgcaatgagtgcagcggagagatcttgaacaactgt
tgtgtgatggagtatcaccaggccacaggcaccctcagcgcccacttcaggaacatgtcg
ctaaagaggatcaagcgcgctgaccggcgaggcgcagagtccgtgacggaggagaagttc
acggtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgttccaggtgaag
accctgtcccttcctgtggttgtcatcgttcacggcagccaggaccacaatgctactgcc
accgtgctgtgggacaatgcctttgctgagccgggcagggtgccgtttgcggtgcctgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctgttcaacagc
ggtagcagccacctcgaggactacaacggcatgtccgtgtcctggtcccagttcaacagg
gagaacttgccaggctggaactacaccttctggcagtggttcgatggggtcatggaggtg
ctgaagaaacatcacaagccccattggaatgacggggccatcctaggttttgtgaataag
caacaggcccatgacctgctcatcaacaagcccgacggcaccttcttgttgcgctttagc
gactcagaaatagggggcatcaccattgcctggaagtttgactctcctgaccgtaacctg
tggaatctgaagccgttcaccacgcgggatttctccatccggtccctggccgaccggctg
ggggacctgagctatctcatctacgtgtttcccgaccggcccaaagatgaggtcttctcc
aagtactatactcctgtgctcgctaaagcagtggacggatacgtgaagccacagatcaag
caagtggtccctgagtttgtgagcgcctctgcggactctgccgggggcagcgccacctac
atggaccaggccccctccccagccgtgtgcccccaggctcattataacatgtacccacag
aaccctgaccccgtcctcgaccaggatggagaattcgacctggatgagaccatggatgtg
gcccggcacgtggaggaactcttacgccgccctatggacagtctggacccccgcctctcc
ccgcctactggtctcttcacctctgccagaggctcgctctcgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020607
Entry
103020607         CDS       T03086                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A-like
  KO
K11223  signal transducer and activator of transcription 5A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04012  ErbB signaling pathway
bacu04217  Necroptosis
bacu04630  JAK-STAT signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04917  Prolactin signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103020607
   04630 JAK-STAT signaling pathway
    103020607
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103020607
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103020607
   04659 Th17 cell differentiation
    103020607
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103020607
   04935 Growth hormone synthesis, secretion and action
    103020607
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020607
   05203 Viral carcinogenesis
    103020607
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103020607
   05220 Chronic myeloid leukemia
    103020607
   05223 Non-small cell lung cancer
    103020607
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103020607
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103020607
   05161 Hepatitis B
    103020607
   05162 Measles
    103020607
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103020607
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103020607
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 103020607
NCBI-ProteinID: XP_007177851
UniProt: A0A383ZRV2
LinkDB
Position
Un
AA seq 794 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRPQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSSSGILVDAMSQKHLQINQTLEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
GSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVSASADSAGGSATY
MDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPRLS
PPTGLFTSARGSLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgcgcttcgccagatgcaggtg
ctgtatgggcaacactttcccatcgaggtccggcattacctagcgcagtggatcgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgaccccaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcattacgccacgcagctccagaacacgtatgaccgc
tgccccatggaattggtgcgctgcatccgccatattctgtacaatgaacaaaggctggtc
cgagaagccaacaatggtagttcttcttctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacacttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccaatatcaagagagcctg
aggatacaggctcagtttgcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggacgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagctgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
acagacatcatctcagccctggtgaccagcacgttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tcgctgctcaagaacgagaacacccgcaatgagtgcagcggagagatcttgaacaactgt
tgtgtgatggagtatcaccaggccacaggcaccctcagcgcccacttcaggaacatgtcg
ctaaagaggatcaagcgcgctgaccggcgaggcgcagagtccgtgacggaggagaagttc
acggtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgttccaggtgaag
accctgtcccttcctgtggttgtcatcgttcacggcagccaggaccacaatgctactgcc
accgtgctgtgggacaatgcctttgctgagccgggcagggtgccgtttgcggtgcctgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctgttcaacagc
ggtagcagccacctcgaggactacaacggcatgtccgtgtcctggtcccagttcaacagg
gagaacttgccaggctggaactacaccttctggcagtggttcgatggggtcatggaggtg
ctgaagaaacatcacaagccccattggaatgacggggccatcctaggttttgtgaataag
caacaggcccatgacctgctcatcaacaagcccgacggcaccttcttgttgcgctttagc
gactcagaaatagggggcatcaccattgcctggaagtttgactctcctgaccgtaacctg
tggaatctgaagccgttcaccacgcgggatttctccatccggtccctggccgaccggctg
ggggacctgagctatctcatctacgtgtttcccgaccggcccaaagatgaggtcttctcc
aagtactatactcctgtgctcgctaaagcagtggacggatacgtgaagccacagatcaag
caagtggtccctgagtttgtgagcgcctctgcggactctgccgggggcagcgccacctac
atggaccaggccccctccccagccgtgtgcccccaggctcattataacatgtacccacag
aaccctgaccccgtcctcgaccaggatggagaattcgacctggatgagaccatggatgtg
gcccggcacgtggaggaactcttacgccgccctatggacagtctggacccccgcctctcc
ccgcctactggtctcttcacctctgccagaggctcgctctcgtga

DBGET integrated database retrieval system