KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102997453
Entry
102997453         CDS       T03086                                 

Gene name
WNT6
Definition
(RefSeq) Wnt family member 6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102997453 (WNT6)
   04390 Hippo signaling pathway
    102997453 (WNT6)
   04150 mTOR signaling pathway
    102997453 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102997453 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102997453 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102997453 (WNT6)
   05205 Proteoglycans in cancer
    102997453 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102997453 (WNT6)
   05226 Gastric cancer
    102997453 (WNT6)
   05217 Basal cell carcinoma
    102997453 (WNT6)
   05224 Breast cancer
    102997453 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102997453 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    102997453 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102997453 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102997453 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    102997453 (WNT6)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   102997453 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 102997453
NCBI-ProteinID: XP_007188081
LinkDB
Position
Un
AA seq 332 aa
MQPPAPSRLRLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLHAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLA
VRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAV
RTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQES
VQLEENCLCRFHWCCVVQCHRCRVRKELSLCL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcagccgcccgcgccctcccgcctgaggctgctgctcctgctgctcctgtgtccggcg
cacgtcggcggactgtggtgggccgtgggcagccccttggtcatggaccctaccagcatc
tgcaggaaggcacggcggctagcagggcggcaggctgagttgtgccaggccgagccggaa
gttgtggccgagctggcgcgcggcgcccggctaggggttcgagaatgccagttccagttc
cgcttccgccgctggaactgctccagccacagcaaggcctttgggcgcatccttcagcag
gacatccgggagacggccttcgtgtttgccataacggccgcgggcgccagccacgcggtc
acgcaggcctgctccatgggcgagctgctgcacgccgcgtgggagtggggaggctgcggc
gacgacgtggacttcggggatgagaagtcgaggctctttatggacgcgcagcacaagcgg
ggacgcggagacatccgtgcgttggtgcaacttcacaacaacgaggcgggccggctggcc
gtgcggagccacacgcggaccgaatgcaagtgccatggcctgtcgggctcatgcgcgctg
cgcacctgctggcagaagttgcccccattccgcgaggtgggcgcgcggctgctcgagcgc
ttccacggcgcctcgcgtgtcatgggcaccaacgacggcaaggctctgctgcccgctgtc
cgcacgctcaagccgccgggccgcgctgacctactgtacgccgccgactcgcccgacttc
tgcgcccccaaccggcgcaccggttcgccgggcacgcgcggccgcgcctgcaacagcagt
gccccggacctcagcggctgcgacctgctgtgctgcggccgcggccaccgccaggagagc
gtgcagctcgaggagaactgtctgtgccgcttccactggtgctgcgtagtgcagtgccac
cgctgccgcgtgcgcaaggaactcagcctctgcctctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000687
Entry
103000687         CDS       T03086                                 

Gene name
WNT10A
Definition
(RefSeq) Wnt family member 10A
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103000687 (WNT10A)
   04390 Hippo signaling pathway
    103000687 (WNT10A)
   04150 mTOR signaling pathway
    103000687 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103000687 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103000687 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103000687 (WNT10A)
   05205 Proteoglycans in cancer
    103000687 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103000687 (WNT10A)
   05226 Gastric cancer
    103000687 (WNT10A)
   05217 Basal cell carcinoma
    103000687 (WNT10A)
   05224 Breast cancer
    103000687 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103000687 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    103000687 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103000687 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103000687 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103000687 (WNT10A)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103000687 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 103000687
NCBI-ProteinID: XP_007188004
UniProt: A0A384ALD2
LinkDB
Position
Un
AA seq 417 aa
MGSTHPCPWLRLRPRPQPRPALCALLFFLLLLAAALPRSSPNDILGLRLPQEPVLNANTV
CLTLPGLSKRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAISAAGVVHAVSNACALGKLRACGCDVSRRGDEEAFRRKLHRLQLE
ALQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGPPSPAPDIPGSRRRAGTADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcacccacccttgcccctggctgcggctccgacctcggccccagccgcggccc
gcgctctgcgcgctcctcttcttcctactgctgctggctgccgccttgcccaggtcttca
cccaatgatattctgggcctccgcctcccccaggagcccgtgctcaacgccaacacagtg
tgcctgacattgccaggcctaagcaagcggcagatggaggtgtgtgtgcgccaccctgac
gtggccgcctcagccatccagggcatccagatcgccatccatgagtgccagcaccagttc
cgggaccagcgctggaactgctctagtcttgagactcgaaacaagatcccctatgagagt
cccatcttcagcagaggtttccgagagagtgccttcgcctacgccatctcggcagctggc
gtggtgcacgctgtatccaatgcctgcgccctgggcaagctgagggcatgtggctgcgac
gtgtcccggcgtggggacgaggaggccttccgtcggaagttgcaccgcctgcagctggaa
gcgctgcagcgcggtaagggcctgagccacggagttcccgagcaccctgccctgcctcct
gccagcccaggcctgcaggactcctgggagtggggcggctgcagccccgacgtgggtttc
ggagagcgcttctctaaagactttctggactcccgggagcctcacagagacatccatgcg
cgcatgaggctccacaacaaccgagtggggaggcaggcggtgatggagaacatgcggcgg
aagtgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
ccggagttccgcgctgtaggggcactgctacgtagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccgggtcccgcggggccaccctcgcca
gccccggacattccggggtctcggcgccgcgccggcaccgccgacctggtctacttcgag
aagtcgcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgcgggcccggacggctgcggcagcatgtgctgtggccgcggc
cacaacatcctacgccagacgcgcagcgagcgctgtcactgccgcttccactggtgctgc
ttcgtggtctgcgaggagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001360
Entry
103001360         CDS       T03086                                 

Definition
(RefSeq) protein Wnt-5a-like
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103001360
   04390 Hippo signaling pathway
    103001360
   04150 mTOR signaling pathway
    103001360
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103001360
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103001360
  09158 Development and regeneration
   04360 Axon guidance
    103001360
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001360
   05205 Proteoglycans in cancer
    103001360
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103001360
   05226 Gastric cancer
    103001360
   05217 Basal cell carcinoma
    103001360
   05224 Breast cancer
    103001360
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103001360
   05022 Pathways of neurodegeneration - multiple diseases
    103001360
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103001360
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103001360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103001360
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103001360
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103001360
NCBI-ProteinID: XP_007192699
UniProt: A0A384B074
LinkDB
Position
Un
AA seq 204 aa
MESHRLEKSIGILSPGVALGTAGRAMSSKFFLMALAIFISFAQVVIEGNSWWSLGMNNPV
QMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNC
STVDNTSVFGRVMQIGPARPKALPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS
YESARILMNLHNNEAGRRIPGLMF
NT seq 615 nt   +upstreamnt  +downstreamnt
atggagtcccacagattggagaagtcgattggaatattaagtccaggagttgctttgggg
acggctggaagggcaatgtcttccaagttcttcctaatggctttggccatatttatctcc
ttcgcccaggtcgtaatagaaggcaattcttggtggtcgctaggtatgaataaccctgtt
cagatgtcagaagtatatatcataggagcacagcctctgtgcagccaactggcaggactt
tctcaaggacagaagaaactatgccacttgtatcaggaccacatgcagtacatcggagag
ggcgcgaagacaggcatcaaagaatgccagtatcagttccgacaccggaggtggaactgc
agcaccgtggataacacctcagtcttcggcagggtcatgcagataggcccggcgcgccca
aaggccctgccacgggactggctgtggggcggctgcggcgacaacatcgactacggctac
cgcttcgccaaggagttcgtggacgcgcgcgagcgggagcgcatccacgccaagggctcg
tacgagagcgcgcgcatcctcatgaacctgcacaacaacgaggccggccgcaggatacca
ggcctgatgttttga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003752
Entry
103003752         CDS       T03086                                 

Gene name
WNT2
Definition
(RefSeq) Wnt family member 2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103003752 (WNT2)
   04390 Hippo signaling pathway
    103003752 (WNT2)
   04150 mTOR signaling pathway
    103003752 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103003752 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103003752 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103003752 (WNT2)
   05205 Proteoglycans in cancer
    103003752 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103003752 (WNT2)
   05226 Gastric cancer
    103003752 (WNT2)
   05217 Basal cell carcinoma
    103003752 (WNT2)
   05224 Breast cancer
    103003752 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103003752 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    103003752 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103003752 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103003752 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103003752 (WNT2)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103003752 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103003752
NCBI-ProteinID: XP_007195188
UniProt: A0A384B6M1
LinkDB
Position
Un
AA seq 360 aa
MNACLGGIWLWLPLLLTWLSPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHGLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSPGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSPDWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcctgtctcggtggaatctggctctggctccctctgctcttgacctggctcagc
cctgaggtcagctcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccgccagcggcagctgtgccaccgacacccggac
gtgatgcgtgccatcggcctgggcgtggccgagtggacagcagagtgccagcaccagttc
cgccagcaccgctggaactgcaacaccctggacagggatcacggcctcttcggcagggtc
ctgcttcgaagtagccgggaatctgcctttgtttacgccatctcttcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgtgacccaaag
aagaagggaaccgccaaggacagcaagggcactttcgactggggtggctgcagtgataac
attgactatgggatcaagtttgcccgagcctttgtggacgccaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagccggcaggaaggctgtaaagcgg
ttcttgaaacaggagtgcaagtgtcatggcgtgagcggctcatgtaccttgaggacctgc
tggctggccatggctgacttcagaaaaacgggcgactatctctggaggaagtacaacgga
gccatccaagttgtaatgaaccaggatggcactggtttcactgtggctaacaagaggttt
aaaaagccgacgaaaaatgacctcgtgtattttgagaattctccagactactgtatccgg
gaccgagatgcaggctccccgggtacagcaggccgtgtgtgcaacctgacttcccgaggc
atggacagctgcgaagtcatgtgctgtgggagaggctatgacacctcccacgtcacccgg
atgaccaagtgcgagtgtaagttccactggtgctgtgctgtgcgctgccaggactgcctg
gaagccctggatgtgcacacgtgcaaggccccgaagagccccgactgggcggctcccaca
tga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004198
Entry
103004198         CDS       T03086                                 

Gene name
WNT8A
Definition
(RefSeq) Wnt family member 8A
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103004198 (WNT8A)
   04390 Hippo signaling pathway
    103004198 (WNT8A)
   04150 mTOR signaling pathway
    103004198 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103004198 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103004198 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004198 (WNT8A)
   05205 Proteoglycans in cancer
    103004198 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103004198 (WNT8A)
   05226 Gastric cancer
    103004198 (WNT8A)
   05217 Basal cell carcinoma
    103004198 (WNT8A)
   05224 Breast cancer
    103004198 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103004198 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    103004198 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103004198 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103004198 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103004198 (WNT8A)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103004198 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103004198
NCBI-ProteinID: XP_007172329
UniProt: A0A383ZBQ6
LinkDB
Position
Un
AA seq 352 aa
MGDLFMFRVAVGICYATFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLANFREMGNYLKAKYDRALKIEMDKRRLRAGNSAEGHWAPTEA
FLPSAEAELIFLEESPDYCTRNSSLGIYGTEGRECLQNSHNTSRWEQCSCGRLCTECGLQ
VEEKRTEAISSCNCKFQWCCTVKCDQCRHVVSKYYCTRSPGSAWSQGKGSTR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggggacttgtttatgttcagggtggctgtgggcatatgctatgcaaccttcagtgcc
tctgcctggtcagtgaacaatttcctgataacaggtcccaaggcctatctgacctacacc
accagtgtggccctgggtgcccagagtggcattgaggagtgtaagttccaatttgcttgg
gaacgctggaactgccctgaaaatgctctccagctttccactcacaacaggctgagaagt
gccaccagggagacttccttcattcatgctatcagctctgctggagtcatgtacaccatc
accaagaactgtagcatgggcgactttgaaaactgtggctgtgatgagtcaaaaaatgga
aaaacaggaggccatggctggatctggggaggctgcagcgacaatgtagagtttggggaa
agaatctccaaactcttcgtggacagcctggagaaggggaaggatgccagagccctgatg
aatcttcataacaacagggcaggcaggctggcagtgagagccaccatgaaaaggacttgc
aaatgtcatggcatctcggggagctgtagtatccagacatgctggctgcagctggctaac
ttccgggagatgggcaactacctaaaggccaagtatgaccgggcactgaaaattgagatg
gataagcggcggctaagggctgggaacagtgccgagggccactgggcacccactgaggcc
ttccttcctagtgcagaagctgagctgatctttttagaggaatcgcctgattactgtacc
cgcaattccagcttgggcatctatggcacagagggtcgggagtgtctgcagaacagccac
aatacatccaggtgggagcaatgcagctgcgggcgcttgtgtacagagtgtggcctgcag
gtggaagagaagagaactgaggctataagcagctgtaactgcaaattccagtggtgctgc
acggtcaagtgtgaccagtgtaggcatgtggtgagcaagtattactgcacgcgctcccca
ggcagtgcttggtcccagggcaagggcagcacacgatag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004744
Entry
103004744         CDS       T03086                                 

Gene name
WNT7B
Definition
(RefSeq) Wnt family member 7B
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103004744 (WNT7B)
   04390 Hippo signaling pathway
    103004744 (WNT7B)
   04150 mTOR signaling pathway
    103004744 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103004744 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103004744 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004744 (WNT7B)
   05205 Proteoglycans in cancer
    103004744 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103004744 (WNT7B)
   05226 Gastric cancer
    103004744 (WNT7B)
   05217 Basal cell carcinoma
    103004744 (WNT7B)
   05224 Breast cancer
    103004744 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103004744 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    103004744 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103004744 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103004744 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103004744 (WNT7B)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103004744 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103004744
NCBI-ProteinID: XP_007189370
UniProt: A0A384APU2
LinkDB
Position
Un
AA seq 535 aa
MPLEKEDSERTQFTLSTKITGSRSSEDSVSWSEPSTRRCDSGRRIPRGGPFKATSPWSQL
PWPPVGYTPLPPVGVFLCQPSLYGHPTHTGSDPCRDLPVLVPLWDCMWGWLQWSPQIFRY
EFLMVTATLGSRGIRILWASPSIGREAVSSPALEAYKQTRERGLGMMGKGLAWQEARTPG
PLCEAAMRALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQ
FRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDRE
KQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEERM
KLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNVAVQVEVVRASRLRQPTFLRIKQ
LRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTH
QYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCKNPWKCVFRLLTSQVGRTLAWGE
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgccgctggagaaagaggactctgagcggactcagtttaccctgtcgaccaagatcacg
ggaagccggagctcagaagacagcgtgtcctggagtgaaccctccaccaggcgctgtgat
tcagggcgccgcattcccagaggaggtcccttcaaggccacctccccttggtctcagctg
ccgtggcctcccgtgggctacacccctctccctcctgtcggggtgttcctgtgccagccg
tccctctacggccaccccacccacacaggctcagacccgtgcagggacctgcctgtcttg
gtcccgctgtgggactgtatgtggggctggctgcagtggtccccccagatcttccggtac
gagtttctcatggtgaccgccactctggggagcaggggcatccgtatcctctgggccagc
ccctctattggcagggaggcagtgagctctccagccctggaggcatacaagcagacgcgg
gagcgagggctcgggatgatggggaaaggccttgcctggcaggaagccagaactcctggt
cctctgtgtgaggcagccatgcgagcgctgtcgtccgtcgtggccctgggagccaacatc
atctgcaacaagatccctggcttggccccgcggcagcgtgccatctgccagagccggccc
gatgccatcatcgtgattggggagggggcgcagatgggcatcaacgagtgccagtaccag
ttccgcttcggacgctggaactgctccgccctcggcgagaagactgtcttcgggcaagag
ctccgagtagggagccgtgaggccgccttcacatacgccatcaccgcagccggcgtggct
cacgccgtcaccgccgcctgcagccagggcaacctgagcaactgcgggtgcgaccgcgag
aagcagggctactacaaccaggccgagggctggaagtggggcggctgctccgccgacgtg
cgctacggcatcgacttctcccggcgcttcgtggacgcccgcgagatcaagaaaaacgcg
aggcgcctcatgaacctgcacaacaatgaggcgggcaggaaggtcctggaggagcgcatg
aagctggagtgcaagtgccacggcgtgtcaggctcgtgcaccaccaagacgtgctggacc
acgctgcccaagttccgcgaggtgggccacctgctcaaggagaagtacaacgtggcggtg
caggtggaggtggtgcgggccagccgcctgcggcagcccaccttcctgcgcatcaagcag
ctgcgcagctaccagaagcccatggagacggacctggtgtacatcgagaagtcgcccaac
tactgcgaggaggacgcggccacgggcagcgtgggcacccagggccgcctgtgcaaccgc
acctcgcccggcgcggatggctgcgacaccatgtgctgcggccgcggctacaacacccac
cagtacaccaaggtctggcagtgcaactgcaagttccactggtgctgcttcgtcaagtgc
aacacgtgcagcgagcgcaccgaggtcttcacctgcaaaaacccgtggaaatgtgtcttc
aggctactgaccagccaagtgggccggacattagcctggggtgagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009300
Entry
103009300         CDS       T03086                                 

Gene name
WNT4
Definition
(RefSeq) Wnt family member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04919  Thyroid hormone signaling pathway
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103009300 (WNT4)
   04390 Hippo signaling pathway
    103009300 (WNT4)
   04150 mTOR signaling pathway
    103009300 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103009300 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103009300 (WNT4)
   04916 Melanogenesis
    103009300 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    103009300 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103009300 (WNT4)
   05205 Proteoglycans in cancer
    103009300 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103009300 (WNT4)
   05226 Gastric cancer
    103009300 (WNT4)
   05217 Basal cell carcinoma
    103009300 (WNT4)
   05224 Breast cancer
    103009300 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103009300 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    103009300 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103009300 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103009300 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103009300 (WNT4)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103009300 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103009300
NCBI-ProteinID: XP_007175144
LinkDB
Position
Un
AA seq 281 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAI
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRER
SKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALK
EKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRT
CNKTSKAIDGCELLCCGRGFHTAQAGIRLHPGSETPAGPSR
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtgcaagcggaacctggaggtgatggactcggtgcgccgcggcgcccagctcgccatc
gaggagtgccagtaccagttccggaaccggcgctggaactgctccacgctcgactcgctg
cctgttttcggcaaggtggtgacgcaagggactcgggaggcggccttcgtgtacgccatc
tcttcggcaggtgtggccttcgcggtgacgcgggcgtgcagcagtggggagctggaaaag
tgcggctgtgaccggacggtacacggggtcagcccacagggcttccagtggtcgggatgc
tcggacaacatcgcctacggcgtggccttctcacagtcattcgtggacgtgcgggagagg
agcaagggggcctcgtccagccgggccctcatgaacctccacaacaacgaggccggcagg
aaggctatcctgactcacatgcgggtggagtgcaagtgccacggggtgtcgggctcctgc
gaggtaaagacgtgctggcgagccgtgccgcccttccgccaggtgggccacgcgctgaag
gagaagtttgacggcgccacggaggtggagccacgccgcgtgggctcctccagggcgctg
gtgccgcgcaacgcgcagttcaagccgcacacagatgaggacctggtgtacttggagccc
agcccggacttctgcgagcaggacatgcgcagcggcgtgctgggcacgaggggccgcacg
tgcaacaagacgtccaaggccatcgacggctgtgagctgctgtgctgcggccgcggcttc
cacacagcacaggcaggaatacggctgcatcctggatcagagaccccagctgggccttca
cggtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012928
Entry
103012928         CDS       T03086                                 

Gene name
WNT9A
Definition
(RefSeq) Wnt family member 9A
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103012928 (WNT9A)
   04390 Hippo signaling pathway
    103012928 (WNT9A)
   04150 mTOR signaling pathway
    103012928 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103012928 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103012928 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012928 (WNT9A)
   05205 Proteoglycans in cancer
    103012928 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103012928 (WNT9A)
   05226 Gastric cancer
    103012928 (WNT9A)
   05217 Basal cell carcinoma
    103012928 (WNT9A)
   05224 Breast cancer
    103012928 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103012928 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    103012928 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103012928 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103012928 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103012928 (WNT9A)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103012928 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 103012928
NCBI-ProteinID: XP_007170004
UniProt: A0A383Z550
LinkDB
Position
Un
AA seq 455 aa
MSSRASFGDPRCNLQMGTPGSGWHRVGSPPDLPSLPASLPRATPGAEATLASCPVPVLRA
LRPFPGCRPPPVVTCSLFPGPGAGAQRPGRQRAPLTRETRLSLVDGGPGGWQALCQPHRQ
RRLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLMEAVSMSA
LECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCT
CDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAG
VETTCKCHGVSGSCTVRTCWRQLAPFHEVGKRLKHKYETALKVGSTTNEATGEAGALSPP
RGRATGTGGGDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNT
QSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtccagccgggcgagctttggggaccctcgctgtaatctgcagatgggcacaccgggg
tctgggtggcatcgtgtgggcagtcctccggatctccccagtctccccgcctccttaccc
cgtgccactcctggagccgaggccaccctcgcgtcctgcccagtccctgtcctgcgtgcc
ctgcggccgttcccgggctgccgccctccacccgtcgtcacctgttccctcttccctgga
ccaggcgccggcgcgcagcggcctggccggcagagggccccgttgacaagagagacaaga
ctcagcttggtggacggaggtcctggaggatggcaggctctgtgccagccccacaggcag
aggaggctgacgggcagtgagcccctgaccatcctcccgctgaccctggagccggaagca
gctgcccaggcacactacaaggcctgtgaccggctgaagctggagcgcaagcagcggcgc
atgtgccgccgggaccccggtgtggctgagacgctgatggaagcggtcagcatgagtgct
ctcgagtgccagtaccagttccggtttgagcgctggaactgtaccttggagggtcgctac
cgggccagcctgctcaagcgaggcttcaaggagacagccttcctttacgccatctcctct
gctggcctgacgcatgcactggccaaggcgtgcagtgcaggccgcatggagcgctgcact
tgtgatgaggcccctgacttggagaaccgagaggcctggcagtggggtggctgcggggac
aatctcaagtacagcagcaagttcgtcaaggagttcctgggtcggcggtctagcaaggat
ctgcgagcccgtgtggatttccacaacaacctcgtgggtgtgaaggtgatcaaggccggg
gtggagaccacgtgcaagtgccatggcgtgtcaggctcctgcaccgtgcggacgtgctgg
cggcagctggcgcctttccacgaggtgggcaagcgcctgaagcacaagtacgagacagca
ctcaaggtgggcagcaccaccaatgaggccaccggcgaggccggcgccctctcaccaccg
cggggccgcgccacagggacgggtggcggcgacccactgccccgcacaccggagctagtg
cacctggacgactcacccagcttctgcctggccggccgcttctccccaggcactgccggc
cgcaggtgccaccgtgagaagaactgcgagagcatctgctgcgggcgtggtcacaacaca
cagagtcgggtggtgacccggccttgccagtgccaggtgcgctggtgctgctatgtggag
tgcaggcagtgtacccagcgcgaggaggtctacacctgcaagggctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013943
Entry
103013943         CDS       T03086                                 

Gene name
WNT2B
Definition
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103013943 (WNT2B)
   04390 Hippo signaling pathway
    103013943 (WNT2B)
   04150 mTOR signaling pathway
    103013943 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103013943 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103013943 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013943 (WNT2B)
   05205 Proteoglycans in cancer
    103013943 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103013943 (WNT2B)
   05226 Gastric cancer
    103013943 (WNT2B)
   05217 Basal cell carcinoma
    103013943 (WNT2B)
   05224 Breast cancer
    103013943 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103013943 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    103013943 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103013943 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103013943 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103013943 (WNT2B)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103013943 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103013943
NCBI-ProteinID: XP_007169449
UniProt: A0A383Z3K1
LinkDB
Position
Un
AA seq 394 aa
MLRPGGAEEAAQLPFRSVRAPVSAPAPRPTGPDGSRASARLSLACLLLLLLLLTLPARVD
TSWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWN
CTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHH
DQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLEC
KCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRT
DLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCEC
KFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgctgaggccgggtggtgcggaagaagccgcgcagctcccctttcggagcgtccgcgcc
cctgtctccgcgcctgcgcctagacccacgggccccgacggctctcgggcttcggcccgc
ctaagtcttgcttgccttctgctgctgctgctgctgctgacgctgccggcccgcgtagac
acgtcctggtggtacatcggggcgctgggggcccgagtgatctgtgacaatatccctggt
ctggtgagccggcagcgtcagctgtgccagcgttacccagacatcatgcgctcggtgggc
gagggtgcccgagaatggatccgagagtgtcagcaccagttccgccaccatcgctggaac
tgcaccaccctggaccgggaccacactgtctttggccgtgtcatgctcagaagtagccgg
gaggcagcatttgtatatgccatctcatcagcaggggtggtccatgctatcactcgtgcc
tgtagccagggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacatcat
gaccaacgtggggactttgactggggtggctgcagtgacaacatccactatggtgttcgt
tttgccaaagccttcgtggatgccaaggagaagaggcttaaggatgcacgggctctcatg
aacttacataacaatcgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgt
aagtgccatggcgtgagtggctcctgtactctgcgcacctgctggcgtgcactctcagac
ttccgccgcacaggtgattacctgcggcggcgctatgatggggctgtgcaggtaacggcc
acccaggatggcgcgaacttcacggcagcccgccaaggctatcgccgtgctacccggact
gaccttgtctactttgataactccccagactactgcgtcttggacaaggctgcaggttcc
ctaggcactgcaggccgagtctgtagcaagacatctaaagggacagacggttgtgaaatc
atgtgctgcggtcgagggtatgacacaactcgagttacccgtgtcacccagtgtgagtgc
aaattccactggtgctgtgctgtgcggtgcaaggagtgcagaaacactgtggatgtccac
acttgcaaggcccccaagaaggcagagtggctggatcagacctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014029
Entry
103014029         CDS       T03086                                 

Gene name
WNT8B
Definition
(RefSeq) Wnt family member 8B
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103014029 (WNT8B)
   04390 Hippo signaling pathway
    103014029 (WNT8B)
   04150 mTOR signaling pathway
    103014029 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103014029 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103014029 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014029 (WNT8B)
   05205 Proteoglycans in cancer
    103014029 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103014029 (WNT8B)
   05226 Gastric cancer
    103014029 (WNT8B)
   05217 Basal cell carcinoma
    103014029 (WNT8B)
   05224 Breast cancer
    103014029 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103014029 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    103014029 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103014029 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103014029 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103014029 (WNT8B)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103014029 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103014029
NCBI-ProteinID: XP_007187420
UniProt: A0A384AJC8
LinkDB
Position
Un
AA seq 322 aa
MTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVH
AISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDA
LETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLK
EKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEG
RECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVT
KYFCSRADRPRGGAAHKPGTKP
NT seq 969 nt   +upstreamnt  +downstreamnt
atgactggtccaaaggcttacttgatctactccagcagcgtggcagctggtgcccagagt
ggtattgaagaatgcaaataccagtttgcctgggaccgctggaactgccctgagagagcc
ctgcagctgtccagccatggtggccttcgcagtgctaatcgggagacagcatttgtacat
gccatcagttctgccggggttatgtacactctgactagaaactgcagccttggggatttt
gacaactgtggctgtgatgactcccgcaatgggcaactggggggccaaggctggctgtgg
ggaggctgcagcgacaacgtgggcttcggagaggcaatatccaagcagttcgtcgatgcc
ctggagacaggacaggatgctcgggcagccatgaacctgcacaacaacgaggctggccgc
aaggcggtgaagggcaccatgaaacgcacgtgtaagtgccacggcgtgtctggcagctgc
accacgcagacctgctggctgcagctgcctgagttccgagaggtgggcgcgcacctgaaa
gagaagtaccacgcagctctcaaggtggacctgctgcagggtgctggcaacagcgcggcg
ggccgcggcgccatcgcagacacctttcgctccatctccacgagggagctggtgcacctg
gaggactccccagactactgcctggagaacaaaacgctaggactgctgggcaccgaaggc
agagagtgcctgcggcgcggccgggccctgggccgctgggagcgccgtagctgccgtcgg
ctctgcggggactgtgggctggcggtggaggagcgccgcgccgagaccgtgtccagctgc
aactgcaagttccactggtgctgcgccgtccgctgcgagcagtgccgccgccgggtcacc
aagtacttctgcagtcgcgcggaccggccgcgggggggcgcggcgcacaagcccgggaca
aaaccctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015001
Entry
103015001         CDS       T03086                                 

Gene name
WNT3
Definition
(RefSeq) Wnt family member 3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103015001 (WNT3)
   04390 Hippo signaling pathway
    103015001 (WNT3)
   04150 mTOR signaling pathway
    103015001 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103015001 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103015001 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015001 (WNT3)
   05206 MicroRNAs in cancer
    103015001 (WNT3)
   05205 Proteoglycans in cancer
    103015001 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103015001 (WNT3)
   05226 Gastric cancer
    103015001 (WNT3)
   05217 Basal cell carcinoma
    103015001 (WNT3)
   05224 Breast cancer
    103015001 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103015001 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    103015001 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103015001 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103015001 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103015001 (WNT3)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103015001 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103015001
NCBI-ProteinID: XP_007175912
UniProt: A0A383ZLD2
LinkDB
Position
Un
AA seq 355 aa
MEPHLLGLLLGLLLCGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctctgtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacatccctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgaaatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatcgacgacagcctggccatc
ttcgggcccgtcctcgacaaagccacccgcgaatcggccttcgtgcacgccatcgcctca
gccggcgtggccttcgccgtcacacgctcctgtgccgagggcacctccaccatctgtggc
tgcgactcgcatcataaagggccgcccggcgagggctggaagtggggcggctgcagcgag
gacgccgacttcggggtgcttgtgtcccgggagttcgcggacgcacgtgagaacaggccg
gatgcgcgctcggccatgaacaagcacaacaacgaagctggccgcacgaccatcctggac
cacatgcacctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtcaagacctgc
tggtgggcccagcccgacttccgcgccatcggggacttcctcaaggacaagtacgacagc
gcctcggagatggtggtggagaagcaccgggagtcccgtggctgggtggagaccctccgc
gccaagtacgcgctcttcaagccgcccactgagagggacctggtctactacgagaactcc
cccaacttttgcgagcccaaccccgagacgggctccttcggcaccagggaccggacttgc
aatgtcacctcccatggcatcgatggctgcgacctgctctgctgcggccgcggccacaac
acaaggacggagaagcggaaggagaaatgccactgcatcttccactggtgctgctacgtg
agctgccaggagtgtatccgcatctacgatgtgcacacctgcaagtag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016115
Entry
103016115         CDS       T03086                                 

Gene name
WNT11
Definition
(RefSeq) Wnt family member 11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103016115 (WNT11)
   04390 Hippo signaling pathway
    103016115 (WNT11)
   04150 mTOR signaling pathway
    103016115 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103016115 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103016115 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016115 (WNT11)
   05205 Proteoglycans in cancer
    103016115 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103016115 (WNT11)
   05226 Gastric cancer
    103016115 (WNT11)
   05217 Basal cell carcinoma
    103016115 (WNT11)
   05224 Breast cancer
    103016115 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103016115 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    103016115 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103016115 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103016115 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103016115 (WNT11)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103016115 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103016115
NCBI-ProteinID: XP_007194124
UniProt: A0A384B321
LinkDB
Position
Un
AA seq 354 aa
MRARPQLCQALLFALALQTSVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSHGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcagctctgccaggcgctgctcttcgccctggcgctccagaccagt
gtgtgctatggcatcaagtggctggcgctctccaagaccccggcggccctggcactgaac
cagacgcaacactgcaagcagctggagggcctggtgtccgcgcaggtgcagctgtgccgc
agcaacctggagctcatgcacaccatcgtgcacgccgcccgcgaggtcatgaaggcctgc
cgccgggccttcgcggacatgcgctggaactgctcctccatcgagctcgcccccaactac
ctgcttgacctggagagagggacccgggagtcagccttcgtgtatgcgctgtcggcggcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgccgggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgtgcctctctggaaatgaagtgtaagtgccacggggtgtctggctcctgctccatc
cgcacctgctggaaggggctgcaggagcttcgggatgtggccgccgacctcaagacccgc
tacctgtcggccaccaaggtggtgcaccgacccatgggcacccgcaagcaccttgtgccc
aaggacctggacatccggcctgtgaaggactcggagctcgtctatctgcagagctccccc
gacttctgcatgaagaacgagaaggtgggctcccatgggacgcaggacaggcagtgcaac
aagacgtcgcatggcagtgacagctgtgacctcatgtgctgtggacgcggctacaacccc
tacacagaccgtgtggtcgagcggtgccactgcaagtaccactggtgctgctatgtcacc
tgccgcaggtgtgagcgcacggtggagcgctacgtctgcaagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016619
Entry
103016619         CDS       T03086                                 

Definition
(RefSeq) protein Wnt-7a-like
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103016619
   04390 Hippo signaling pathway
    103016619
   04150 mTOR signaling pathway
    103016619
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103016619
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103016619
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016619
   05205 Proteoglycans in cancer
    103016619
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103016619
   05226 Gastric cancer
    103016619
   05217 Basal cell carcinoma
    103016619
   05224 Breast cancer
    103016619
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103016619
   05022 Pathways of neurodegeneration - multiple diseases
    103016619
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103016619
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103016619
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103016619
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103016619
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103016619
NCBI-ProteinID: XP_007183063
LinkDB
Position
Un
AA seq 254 aa
MRKVYTIPGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQ
FRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKE
KQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKGPDTDP
SGHEQGSRLAWGRCQSGPGEGTHWRPPRILQPAIYSKVRDPVPETLPTAGFRGPHAQWSW
NRQEERGQPAAAPG
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcgaaaggtctacaccatccctggcttctcctcggtggtagctctgggcgcgagcatc
atctgtaacaagatcccaggcctggctcccagacagcgggcgatctgccagagccggccc
gacgccatcatcgtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcag
ttccgcaatggccgctggaactgctcggcgctgggggagcgcaccgtcttcggaaaggag
ctcaaagtggggagccgggaggccgccttcacctacgccatcatcgcagccggcgtggcc
cacgccatcactgctgcctgcacccagggcaacctgagcgactgcggctgcgacaaggag
aagcaaggccagtaccaccgggacgagggctggaagtggggtggctgctctgccgacatc
cgctacggcatcggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcc
cggactctcatgaacttacacaataacgaggcgggccgaaagggcccagacacagatccg
agcggccacgagcagggcagccgtctagcctggggaaggtgccagtcagggccaggcgag
ggcacacactggagaccccccaggatcctgcagcctgccatttattcaaaggtgcgggac
cccgttccagaaactctgcccacagcaggcttccgtgggccccatgcacagtggagctgg
aaccggcaggaggagaggggccagcctgcagccgctcctggctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016899
Entry
103016899         CDS       T03086                                 

Gene name
WNT10B
Definition
(RefSeq) Wnt family member 10B
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103016899 (WNT10B)
   04390 Hippo signaling pathway
    103016899 (WNT10B)
   04150 mTOR signaling pathway
    103016899 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103016899 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103016899 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016899 (WNT10B)
   05205 Proteoglycans in cancer
    103016899 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103016899 (WNT10B)
   05226 Gastric cancer
    103016899 (WNT10B)
   05217 Basal cell carcinoma
    103016899 (WNT10B)
   05224 Breast cancer
    103016899 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103016899 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    103016899 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103016899 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103016899 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103016899 (WNT10B)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103016899 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103016899
NCBI-ProteinID: XP_007179347
UniProt: A0A383ZW45
LinkDB
Position
Un
AA seq 389 aa
MREEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCSCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSGPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCTCHGTSGSCQFKTCWRSAPEFRVVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
AERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgggaggagccgcggccgcggcctccgccctcgggcctcgcgggtctcctgttcctg
gctttgtgcagtcgggccctaagcaatgagattctgggtctgaagctgcccggcgagccg
ccgctgaccgccaacaccgtatgcttgacgctgtcgggcctgagcaagcggcagttaggc
ctgtgcctgcgcagccccgacgtgacggcgtccgcgcttcagggcctgcacatcgcggtc
cacgagtgtcagcaccagctgcgtgaccagcgctggaactgctcggcgctcgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgagagagcgctttttcc
ttctccatgctggctgctggggtcatgcatgcggtagccacagcctgcagcctgggcaag
ctggtgagctgcagctgcggctggaagggcagtggcgagcaggatcggctgagggccaaa
ctgctgcagctgcaggctctgtcccggggcaagagttttccccactccctgcccagcccg
ggccccggctcaggccccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtggggcgtcaggtggtaact
gagaacctgaagcggaaatgcacgtgccatggcacatcaggcagctgccagttcaagacg
tgctggaggtcagccccagagttccgggtggtaggggcagccttgagggagcggctgggc
cgggccatcttcattgatactcacaaccgcaactccggagccttccaaccccgccttcgt
ccccgtcgcctctcaggagaactggtctactttgagaagtctcctgacttctgtgagcga
gaccccaccatgggctccccaggcacgcggggccgggcctgcaacaagaccagccgcctg
ctggatggctgtggcagcctgtgctgtggccgcggccacaacgtgctccggcagacacga
gctgagcgctgtcattgccgcttccactggtgctgctacgtgctatgtgatgagtgcaag
gtcacagagtgggtcaacgtgtgtaagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017176
Entry
103017176         CDS       T03086                                 

Gene name
WNT1
Definition
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103017176 (WNT1)
   04390 Hippo signaling pathway
    103017176 (WNT1)
   04150 mTOR signaling pathway
    103017176 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103017176 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103017176 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017176 (WNT1)
   05205 Proteoglycans in cancer
    103017176 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103017176 (WNT1)
   05226 Gastric cancer
    103017176 (WNT1)
   05217 Basal cell carcinoma
    103017176 (WNT1)
   05224 Breast cancer
    103017176 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103017176 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    103017176 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103017176 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103017176 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103017176 (WNT1)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103017176 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103017176
NCBI-ProteinID: XP_007179348
UniProt: A0A383ZW49
LinkDB
Position
Un
AA seq 370 aa
MGHWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGNNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcctggctgggtttccgctacgctgttgctggcgctggcc
gctctgcctgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctccacgaacctgctgaccgactccaagagtctgcaactggtactcgagcccagt
ctgcagctgctgagccgcaaacagcggcggctgatccgccagaacccagggatcctgcac
agtgtgagcgggggactgcagagcgctgtgcgagagtgcaagtggcagttccggaaccgc
cgctggaactgtcccacagcttcggggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgggaaacagcatttatcttcgccatcacctcggccggggtcacccattcggtggcg
cgctcctgctcggagggctccatcgagtcctgcacgtgcgactaccggcggcgcggtcct
gggggccccgattggcactgggggggctgcagcgacaacatcgacttcggccgcctcttt
ggccgggagtttgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcgggccgcacgaccgtgttctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgacgtgctgcgggaccgcttcgacggcgcctcgcgcgtcctgtacggcaat
cgcggcaacaaccgtgcctcgcgggcggaactgctgcgcctcgagcccgaggaccccgct
cacaagcctccctccccccacgatctcgtctacttcgagaaatcgcccaacttctgcaca
tacagcggacgcctgggtacagcgggcacggcagggcgcgcctgcaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgtggccggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacactcgcgtactgcacgagtgcctgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018475
Entry
103018475         CDS       T03086                                 

Gene name
WNT16
Definition
(RefSeq) Wnt family member 16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103018475 (WNT16)
   04390 Hippo signaling pathway
    103018475 (WNT16)
   04150 mTOR signaling pathway
    103018475 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103018475 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103018475 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018475 (WNT16)
   05202 Transcriptional misregulation in cancer
    103018475 (WNT16)
   05205 Proteoglycans in cancer
    103018475 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103018475 (WNT16)
   05226 Gastric cancer
    103018475 (WNT16)
   05217 Basal cell carcinoma
    103018475 (WNT16)
   05224 Breast cancer
    103018475 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103018475 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    103018475 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103018475 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103018475 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103018475 (WNT16)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103018475 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103018475
NCBI-ProteinID: XP_007177313
UniProt: A0A383ZQB8
LinkDB
Position
Un
AA seq 361 aa
MDRAALLGLSRLCALWAALLALFPCGSQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSICEGARLGIQECRSQFRYERWNCLVAAAAPPDASPLFGYELSSGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNDGSASEGWHWGGCSDDVQYGMWFRRXLD
FPIRNTTGKESKVLLAMNLHNNEAGRQAVAKLMSLECRCHGVSGSCAVKTCWKTMSSFEK
IGRLLKDKYENSVQISDKIKRKMHRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPG
TQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTC
K
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggacagagcagcgctcctgggactgtcccgcctgtgcgcgctgtgggcagccctgctc
gcgctgttcccctgcggatcccaaggaaactggatgtggttgggcatcgcctcctttggg
gttccggagaagctgggctgcgccaacttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatctgcgagggcgcccggctgggcattcaggag
tgcaggagccagttcagatacgagagatggaactgcctggtggccgccgccgccccgccg
gacgccagccctctctttggctacgagctgagcagcggcaccaaggaaacagcatttatt
tatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagtgcaggcaac
atgactgagtgttcctgtgacaccaccttgcagaacgacggctcagcaagtgaaggctgg
cactgggggggctgctctgatgatgtccagtatggcatgtggttcagacganttctagat
ttccccatcagaaataccacgggaaaagaaagcaaagtactattagcaatgaacctacat
aacaatgaagctggaaggcaggctgtcgccaagttgatgtcattagagtgccggtgtcac
ggagtttccggctcctgtgctgtgaaaacatgctggaaaaccatgtcttctttcgaaaag
attggccgtctgttgaaggataaatatgaaaacagtgtccaaatctcagacaaaataaag
aggaaaatgcacaggcgagagaaagatcagaggaaaataccaatccacaaggatgatctg
ctctacgttaataagtctcctaattactgtgtagaggataagaaactcgggatcccaggg
acccaaggcagagagtgcaaccgcacgtcagggggcgcagacggctgcaacctcctctgc
tgcggcaggggctacaacactcacgtggtcaggcacgtggagcgatgcgagtgcaagttt
atctggtgctgctatgtccgctgcaggaggtgtgaaagcatgactgatgtccacacttgc
aagtaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020226
Entry
103020226         CDS       T03086                                 

Gene name
WNT5B
Definition
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103020226 (WNT5B)
   04390 Hippo signaling pathway
    103020226 (WNT5B)
   04150 mTOR signaling pathway
    103020226 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103020226 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103020226 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    103020226 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020226 (WNT5B)
   05205 Proteoglycans in cancer
    103020226 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103020226 (WNT5B)
   05226 Gastric cancer
    103020226 (WNT5B)
   05217 Basal cell carcinoma
    103020226 (WNT5B)
   05224 Breast cancer
    103020226 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103020226 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    103020226 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103020226 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103020226 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103020226 (WNT5B)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103020226 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103020226
NCBI-ProteinID: XP_007178714
LinkDB
Position
Un
AA seq 358 aa
MEPVSEAVGPRGLPRALGGRRRTMPSPPALLAAAAALFACWAPLRAAASSWWSLALNPVQ
RPEMFIIGAQPVCSQLPGLSAGQRKLCQLYQEHMAYIGEGARTGIRECQHQFRQRRWNCS
TVDDASVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTYFYLCAKEFVDARER
EKNFAKGSEEQGRVLMNLQNNEAGRRAVYKTADVACKCHGVSGSCSLKTCWLQLAEFRKV
GDQLKEKYDSAAAMRITRRGKLELVNSRFKQPTPEDLVYVDPSPDYCLRDQSTGSLGTQG
RLCNKTSEGLDGCALMCCGRGYDQFKSVQTERCHCKFHWCCFVRCKKCTQVVDQFVCK
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggagcccgtctcggaagccgtcggtccccggggtcttccccgggccctgggagggcgc
aggcggaccatgcccagcccgcctgccctgctcgctgctgctgctgcgctattcgcctgc
tgggccccgcttcgggccgcggccagctcctggtggtctttggctctgaacccggtgcag
aggcctgagatgttcatcatcggggcgcagcccgtgtgcagccagctccccgggctctcc
gccggccagcggaagctgtgccagctgtaccaggagcacatggcctacataggcgagggg
gccaggacgggcatcagggagtgccagcaccagttccggcagcggcggtggaactgcagc
accgtggacgatgcctccgtcttcgggagagtcatgcagataggcagccgggagacggcc
ttcacctacgccgtgagcgcggccggggtggtcaacgccatcagccgcgcctgccgcgag
ggggagctttccacctacttctacctctgcgccaaggagttcgtggacgcccgcgagcgc
gagaagaacttcgccaagggctcggaggagcagggccgcgtgctcatgaacctgcagaac
aacgaggccggccggagggctgtgtataagacggcagacgtggcctgcaaatgccacggc
gtctcggggtcctgcagcctcaagacctgctggctgcagctggcggagttccgcaaggtg
ggggaccagctgaaggagaagtacgacagcgcagctgccatgcgcatcacccgccggggc
aagctggagctggtcaacagccgcttcaagcagcccacccccgaggacctggtctacgtg
gaccccagcccggactactgcctgcgcgaccagagcacgggctcgctgggcacgcagggc
cgcctgtgcaacaagacgtccgagggcctggacggctgcgcgctcatgtgctgcggccgc
ggctacgaccagttcaagagcgtgcagaccgagcgctgccactgcaagttccactggtgc
tgcttcgtccgctgcaagaagtgcacgcaggtcgtggaccagttcgtctgcaagtag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020386
Entry
103020386         CDS       T03086                                 

Gene name
WNT9B
Definition
(RefSeq) Wnt family member 9B
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103020386 (WNT9B)
   04390 Hippo signaling pathway
    103020386 (WNT9B)
   04150 mTOR signaling pathway
    103020386 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103020386 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103020386 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020386 (WNT9B)
   05205 Proteoglycans in cancer
    103020386 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103020386 (WNT9B)
   05226 Gastric cancer
    103020386 (WNT9B)
   05217 Basal cell carcinoma
    103020386 (WNT9B)
   05224 Breast cancer
    103020386 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103020386 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    103020386 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103020386 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103020386 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103020386 (WNT9B)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103020386 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103020386
NCBI-ProteinID: XP_007175925
UniProt: A0A383ZLA3
LinkDB
Position
Un
AA seq 358 aa
MRPPPALALAALCLLALPAAAAAAYFGLTGREVLTPFPGLGTAPAPAQGGAHLKQCDLKK
LSRRQKQLCRREPGLAETLQDAAHLSLLECQFQFRHERWNCSLEGRTGLLKRGFKETAFL
YAVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLNNFLGP
KRGSKDLRARVDAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLK
LRHDSAVKVSSATNEALGRLELWAPARAGSSTKGPAPRPGDLVYMEDSPSFCRPSKYSPG
TAGRGGSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgcgctctgcctgctggcgctgcccgccgcc
gccgccgccgcctacttcggcctgaccgggcgggaggtcctgacacccttcccgggtctg
ggcaccgcccctgccccagcacagggtggggcccacctgaagcagtgtgacctcaagaag
ctgtcccgccggcagaagcagctctgccggcgggagccaggcctggctgagaccctgcag
gatgccgcacacctcagcctgctcgagtgccagtttcagttccggcatgagcgctggaac
tgcagcctagaggggaggacggggctgctcaagagaggtttcaaggagacggccttcctg
tacgcggtgtcctcggccgccctcacgcacactctggcccgggcctgcagcgccgggcgc
atggagcgttgcacctgtgatgactctccaggcctggagagccggcaggcctggcagtgg
ggcgtgtgcggcgacaacctcaagtacagcaccaagttcctgaacaacttcctggggccc
aagagaggaagcaaagacctgcgggcacgggtagatgcccacaacacccacgtgggcatc
aaggccgtgaagagtggcctcaggaccacgtgtaagtgccacggcgtgtcgggctcctgc
gccgtgcgcacctgctggaagcagctctccccattccgcgagacaggccaggtgttaaag
ctgcgccacgactcagccgtcaaggtgtccagtgccaccaacgaggccttgggccgcctg
gagctgtgggcaccagccagagcaggcagctccaccaagggcccggccccacggcctggg
gacctggtctacatggaggactcacccagtttctgccggcccagcaagtactcgcccggc
acggcgggcagggggggctcccgggaggccagctgcagcagcctatgctgcgggcggggc
tatgacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgttgc
tacgtggagtgccagcaatgcgtgcaggaggagcttgtgtacacctgtaagcattag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020927
Entry
103020927         CDS       T03086                                 

Gene name
WNT3A
Definition
(RefSeq) Wnt family member 3A
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103020927 (WNT3A)
   04390 Hippo signaling pathway
    103020927 (WNT3A)
   04150 mTOR signaling pathway
    103020927 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103020927 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103020927 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020927 (WNT3A)
   05206 MicroRNAs in cancer
    103020927 (WNT3A)
   05205 Proteoglycans in cancer
    103020927 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103020927 (WNT3A)
   05226 Gastric cancer
    103020927 (WNT3A)
   05217 Basal cell carcinoma
    103020927 (WNT3A)
   05224 Breast cancer
    103020927 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103020927 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    103020927 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103020927 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103020927 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103020927 (WNT3A)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Morphogens
   103020927 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103020927
NCBI-ProteinID: XP_007169956
UniProt: A0A383Z4E5
LinkDB
Position
Un
AA seq 352 aa
MAPLGYFIFLYGLKQALGNYPIWWSLAVGPQYSSLGTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKISIQECQHQFRGRRWNCTTVNNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECARVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccccgctcggatatttcatattcctctacggcctgaagcaagcgctgggcaactac
ccgatctggtggtccctggctgtcgggccccagtactcatccctggggacacagcccatc
ctctgcgccagcatcccaggcctggtacccaagcagctgcgtttctgccggaactacgtg
gagatcatgcccagtgtggcagagggcatcaagatcagcatccaggagtgccaacaccag
ttccgtggccgccggtggaattgcaccactgtcaacaacagcctggccatctttggccct
gtgctggacaaagccacccgggagtccgcctttgtgcacgccatcgcctccgccggcgta
gccttcgctgtgacacgctcgtgcgccgagggctccgctgccatctgcggctgcagcagc
cgccaccagggttcgcccggtgagggctggaagtggggcggctgcagtgaggacatcgag
ttcggcgggatggtgtctcgggagttcgcagacgcgcgggagaaccgaccagacgctcgc
tccgccatgaaccgtcacaacaatgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccatgggctctcgggcagctgtgaggtgaagacctgctggtggtcg
cagcccgacttccgtgccattggtgacttcctcaaggacaagtatgacagcgcctcggag
atggtggtggagaagcaccgcgagtcgcgcggctgggtggagaccctgcggccacgctac
acctacttcaaggtgcccacagagcgcgacctggtctactacgaggcctcgcccaacttc
tgtgagcccaaccccgagacgggatccttcggcacgcgcgaccgcacctgcaacgtgagc
tcgcacggcatagacggctgcgacctgctgtgctgcggtcgcggccacaacgcgcgcacc
gagcggcgcagggagaagtgccactgcgttttccactggtgctgctacgtgagctgccag
gagtgcgcgcgcgtctatgacgtgcacacctgcaagtag

DBGET integrated database retrieval system